KEGG   Pectobacterium atrosepticum SCRI1043: ECA1362Help
Entry
ECA1362           CDS       T00186                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECA1362 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECA1362 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    ECA1362 (sucB)
Enzymes [BR:eca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ECA1362 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1543336..1544562
Genome map
AA seq 408 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDSVQRDEVLVEIETDKVVLEVPASEAGILDAV
LEEEGATVMSRQLLGRIRRGDSSGKETGEKSQSKESTPAQRHTAGLEEEHSDALSPAIRR
LIAEHNLDASAIKGSGVGGRITREDVDKHLAAQKKDSAKAAKPEAPAASPAPALGARSEK
RVPMTRLRKRVAERLLEAKNSTAMLTTFNEINMQPIMDLRKQYGEAFEKRHGVRLGFMSF
YIKAVVEALKRYPEVNASIDGEDVVYHNYFDVSIAVSTPRGLVTPVLRDVDALGMADIEK
RIKELAVKGRDGKLTVEELLGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMA
VDGQVVILPMMYLALSYDHRLVDGRESVGFLVTVKEMLEDPARLLLDV
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattcttgtacccgacctgcctgaatccgtcgctgacgccactgtg
gctacctggcataaaaagcccggcgatagcgtccagcgtgatgaagtattggttgaaatt
gaaactgacaaagtagtgctggaagttccagcctctgaagccggcattctggatgccgtg
ctggaagaagaaggcgcaaccgtcatgtctcgccagcttctgggccgtattcgccgtggc
gatagctccggtaaagaaactggcgagaaatctcagagtaaagaatcgacaccggcacag
cgtcatacggctggtctggaagaagagcacagcgacgcgctgagcccggctatccgtcgc
ctaattgccgagcacaatctcgacgcgtctgctatcaaaggcagcggcgtaggtggccga
attacccgtgaagatgtggataagcatttggctgcccagaagaaagattctgctaaagcg
gctaagcccgaggctccggcggcttctcctgcacctgctctgggcgcgcgcagcgaaaaa
cgcgtaccgatgacgcgtctgcgtaagcgcgttgcagaacgtctgctggaagcgaaaaac
agcacagcaatgttgacgacgtttaacgaaatcaacatgcagccgatcatggacctgcgc
aagcaatacggcgaagcttttgagaagcgtcacggtgtacgtttgggcttcatgtccttc
tacatcaaagccgtcgttgaagcgctgaagcgttaccctgaagtgaatgcttccattgat
ggcgaagacgtggtttaccacaactatttcgatgtcagcattgcggtttctaccccgcgt
ggtctggttacgccagtactgcgtgatgtggatgcgctgggcatggccgacatcgagaag
cgtatcaaagagctggctgtgaaaggccgtgacggcaaactgacggttgaagaattgttg
ggtggtaacttcacgattaccaacggcggtgtctttggttctctgatgtctaccccgatc
atcaacccgccgcagagtgcgattctgggtatgcacgccattaaagatcgcccaatggcg
gttgatggccaggtggttattctgccgatgatgtatctggcgctttcttacgatcaccgc
ttggttgatggtcgagaatccgttggcttcctcgtgacggtgaaagagatgttggaagat
ccagcgcgtctgctgttagacgtttaa

DBGET integrated database retrieval system