KEGG   Pectobacterium atrosepticum SCRI1043: ECA1363Help
Entry
ECA1363           CDS       T00186                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
eca00020  Citrate cycle (TCA cycle)
eca00640  Propanoate metabolism
eca00660  C5-Branched dibasic acid metabolism
eca01100  Metabolic pathways
eca01110  Biosynthesis of secondary metabolites
eca01120  Microbial metabolism in diverse environments
eca01130  Biosynthesis of antibiotics
eca01200  Carbon metabolism
Module
eca_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eca_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECA1363 (sucC)
   00640 Propanoate metabolism
    ECA1363 (sucC)
   00660 C5-Branched dibasic acid metabolism
    ECA1363 (sucC)
Enzymes [BR:eca01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ECA1363 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: CAG74273
GeneDB: ECA1363
UniProt: Q6D7G2
Position
1544898..1546064
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGLPAPTGYACTTPREAEEAASKIGSGPWVVKCQVHAGGRGKAGGV
KVVSNKEDIRAFAENWLGKKLVTYQTDAQGQPVHQILVEAATDIDKELYLGAVVDRGTRR
VVFMASTEGGVEIEKVAEETPELIHKAAIDPLVGPQPYQGRELAFKLGLSGKQVAQFTKI
FMGLATLFLERDLALVEINPLVITKQGDLICLDGKLGADGNALFRQPELREMRDPSQEDS
REAHAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGSPANFLDVGGGATKERVTE
AFKIILSDDKVKAVFVNIFGGIVRCDLIADGIIGAVAEVGVSVPVVVRLEGNNAELGAKK
LADSGLNIIAATSLTGAAQQVVAAAGDK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgagtatcaggcaaaacaactctttgctcgatatggtttaccggcaccg
accggctatgcctgtactacaccgcgtgaagcagaagaagccgcatctaagattggctcg
ggtccgtgggtcgtaaaatgtcaggttcacgcaggcggtcgcggtaaagcgggcggcgtt
aaagtggtcagcaacaaagaagacattcgcgcttttgctgaaaactggctgggtaaaaag
ctcgttacttatcaaactgacgcacagggccaaccggttcatcagattctggttgaagcg
gcaacggatatcgacaaagagctttatctgggcgcggttgttgaccgtggcacgcgtcgt
gtcgtgttcatggcgtccactgaaggtggcgtagaaattgaaaaagttgcggaagagacg
ccggaactgatccacaaagctgctatcgatccactggtaggcccacagccttatcagggt
cgcgagctggccttcaagctgggtctgagcggcaagcaagttgcccagttcaccaaaatt
ttcatgggtctggcgacgctgttccttgagcgcgatctggcgctggtagaaatcaacccg
ctggttatcactaagcagggcgatctgatctgtctggatggcaaactgggcgcggacggc
aatgcactatttcgtcagcctgagctgcgtgaaatgcgtgacccaagccaggaagattcc
cgtgaagcgcatgcggcacagtgggaactaaactatgttgcgctggatggtaacatcggc
tgtatggtgaacggcgcgggtcttgcgatgggtaccatggacatcgtgaaactgcacggc
ggttctcctgctaacttcctcgatgttggtggtggcgcgacgaaagaacgtgtaactgaa
gcattcaaaattatcctgtctgacgacaaggtaaaagccgtctttgttaacatctttggt
ggcatcgtacgttgcgatttgatcgctgacggtatcatcggcgcggtagccgaagtgggc
gttagcgtaccggttgtggtacgtcttgaaggaaacaatgcagaacttggagccaagaaa
ctggcggatagcggcctgaatattattgccgccaccagcctgacgggtgcggctcagcag
gttgttgcagcagcgggagataaataa

DBGET integrated database retrieval system