KEGG   Pectobacterium atrosepticum SCRI1043: ECA1401Help
Entry
ECA1401           CDS       T00186                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECA1401 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECA1401 (glk)
   00052 Galactose metabolism
    ECA1401 (glk)
   00500 Starch and sucrose metabolism
    ECA1401 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    ECA1401 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ECA1401 (glk)
   00524 Butirosin and neomycin biosynthesis
    ECA1401 (glk)
Enzymes [BR:eca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ECA1401 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1584709..1585674
Genome map
AA seq 321 aa AA seqDB search
MTHFVLVGDVGGTNTRLALCDAMTGELSQIETYSGLDFPSLEGAIRDYLDSRQVTVQDAC
IAIACPITGDWVAMTNHTWAFSIAEMKASLGLRHFEVINDFTAVSMAVPVMGRESLLQFG
GGEPVPGKPVAVYGAGTGLGVAHLVHVANQWVSLPGEGGHVDFAANSDEEDNILTILRQS
LGHVSAERLLSGQGLVNIYRAIVLSDDRTPEALEPKDITERAVNNTDVDCRRALSLFCVI
MGRFGGNLALNLGTFGGVYIAGGIVPRFLEFFKASGFRAAFEDKGRFKGYMQDIPVYLIT
HEQPGLMGAGAYLRQVLGSAL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacgcactttgttttagtgggcgatgtcggcggcaccaatacgcgtttggcgctgtgt
gacgccatgacgggcgaattgtcgcaaattgagacgtattccgggctggatttcccttct
ctggaaggggcgatccgcgattatctcgattcgcggcaggtcacggtgcaggatgcctgt
atcgcgattgcctgcccgattaccggtgactgggtagcgatgacgaaccacacctgggca
ttttccatcgctgaaatgaaagcgagtctgggtttacgccactttgaggttatcaacgat
tttaccgcagtttccatggcggttccggtgatggggcgtgagagtttgctccagttcggt
ggtggggaacctgtgccgggtaagcccgttgccgtgtatggcgcaggcacggggctcggt
gtcgctcatctggttcatgttgccaaccaatgggtcagcctgccgggtgaaggtgggcat
gtggatttcgcggccaatagcgatgaagaagacaacattctgactattttgcgccaatcg
ttggggcatgtttccgcggagcgcttgctgtctggtcaggggctggtgaatatttaccgc
gccatcgtgctatctgacgatcgtacaccggaggcgctggagccgaaggatattaccgaa
cgtgccgtcaacaatactgacgtggattgtcgtcgcgcgctgtcgctattctgcgtcatc
atggggcgcttcggtggtaatttggcgctgaatttaggcacgtttggcggcgtttatatt
gctggcggcatcgtaccgcgctttctggaattttttaaagcctctggctttcgtgcggct
tttgaagataaagggcgatttaaaggctatatgcaggatatccccgtgtatctgattacg
catgaacagccgggattaatgggggcaggggcttatctgcgacaggtgctgggcagcgcg
ctgtaa

DBGET integrated database retrieval system