KEGG   Pectobacterium atrosepticum: ECA1428Help
Entry
ECA1428           CDS       T00186                                 

Gene name
nahO
Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
eca  Pectobacterium atrosepticum
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ECA1428 (nahO)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECA1428 (nahO)
   00650 Butanoate metabolism
    ECA1428 (nahO)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    ECA1428 (nahO)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECA1428 (nahO)
   00622 Xylene degradation
    ECA1428 (nahO)
   00621 Dioxin degradation
    ECA1428 (nahO)
Enzymes [BR:eca01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     ECA1428 (nahO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1621487..1622377
Genome map
AA seq 296 aa AA seqDB search
MTNLNKKVRVGIIGSGNIGTDLLIKTMRSESLTCTIFAGRNFNSAGMKRANELGVHISDR
GIQAILDDPSICDVVFDATSAQAHIEHWRELEPLDKTVIDMTPAKVGGFCIPAINAEEIL
ASGNRNINMVTCGGQSSIPIANAISSVHPEFEYIEVASSIASRSAGPATRANLDEYIDTT
EKALKQFTGAQRTKAILILNPAVPPIDMQTTIYAKIDRPNIAAIDAAVREMVERLKRYVP
GYQLVLPPTLDGNRVVTTVKVMGNGDYLPQYAGNLDIINCAAIAVTEMISSLRYGK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatctaaataaaaaagtacgtgttggcattattggtagcggtaacattggtact
gatttgctaatcaaaactatgcgttctgaatcgcttacatgcacaatttttgccggaaga
aacttcaactctgccggcatgaagcgagctaatgagctcggggtacacatttcagatcgc
ggtattcaggctattctggacgatccttctatttgcgatgtcgtttttgatgcaacttcc
gctcaagctcatattgagcactggcgcgagctggaaccgcttgataaaaccgttattgat
atgacgcctgccaaggtcggtggtttctgcattcctgcgattaatgctgaagagatattg
gcgtcaggtaatcgaaatatcaatatggtcacctgtggggggcaatcctcgattcccatt
gctaatgcgatttcgtccgttcaccctgagtttgaatatatcgaagtggcatcaagcatt
gcctctcggagtgcagggccagccacgcgtgcaaatctggatgaatatattgatacgaca
gaaaaagcgcttaagcagttcactggggctcagcggacgaaagccattctgatattgaac
cctgcggtgccaccgattgatatgcagacgacgatttacgcaaagatagatcgtccaaat
attgctgcaattgatgccgcggtaagagaaatggttgaacggctaaaacgctacgtacct
ggatatcagctagtgttgccgccaacgcttgatggcaaccgtgttgtcactacggttaaa
gtcatgggtaatggcgactacctgccacaatacgctggcaaccttgatattattaattgt
gcggcgattgctgtaacggaaatgatttcttcattgagatatgggaaataa

DBGET integrated database retrieval system