KEGG   Pectobacterium atrosepticum SCRI1043: ECA1443Help
Entry
ECA1443           CDS       T00186                                 

Gene name
galF
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECA1443 (galF)
   00052 Galactose metabolism
    ECA1443 (galF)
   00500 Starch and sucrose metabolism
    ECA1443 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    ECA1443 (galF)
Enzymes [BR:eca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ECA1443 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1637322..1638218
Genome map
AA seq 298 aa AA seqDB search
MTSLKAIIPVAGLGMNLLPVTKAIPKEMLPLVDRPVIEKIVNECVRAGIKEIVLVTHASK
NAIENHFDTSFELESLLEERAKRQLLAEVQSICPKGVTIMNVRQGETLGLGHAVSCARPI
IGDNPFVVVLPDVVLDESTADQTQENLALLISRFEETGRSQVLVKHRPYEVLPEYSVVDC
EAQLVNPGDASAITSMIEKPEAPSETGSDLSAVGRYVLTADAWSLLDKAEPGAWGRIQLT
DVIADMIATQQVDAVQMSGKNFNCGRKLGYAQAFVSYGLRNPEFGAEFKESIKALLKK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgacatcattgaaagctattatccctgtagcaggtttagggatgaatttgttacccgtg
accaaggcaattcctaaggaaatgttgccgttggttgaccgcccggtgattgagaaaatc
gtcaacgagtgtgtgagggcggggattaaagaaattgttctggtgacgcatgcgtcgaaa
aatgctatcgaaaaccacttcgatacctcgtttgaacttgagtctctgttggaagaacgc
gccaagcgccagctgctggccgaagtacagtccatctgtccgaaaggcgtgacgatcatg
aacgtccgtcagggtgaaacgctgggattagggcatgcggtctcctgtgctcgtccaatc
attggggataatccgtttgtagtggtgttgcctgatgtggtgttggatgaaagtacagcc
gatcagacgcaggaaaacctggcgctgctgatttcccgttttgaagaaactgggcgcagt
caagtgctggtgaagcatcgtccttatgaggtgttgccagagtactctgttgtcgattgt
gaagcacagctggtgaacccaggcgatgcctcagcgattacgtcaatgattgagaaacct
gaagcaccgtccgaaactgggtctgacctttctgcggtaggacgctatgtcttaacggcc
gatgcctggtcattgctcgataaagccgaaccaggtgcatggggacgtattcagttaacg
gatgtgattgctgatatgattgcgacccagcaggttgatgctgtacagatgtcgggcaag
aactttaactgtggccgtaaattgggttacgcgcaggcatttgtgtcttacgggttacgc
aatcctgagtttggtgccgaatttaaagaaagtattaaggcgctgctgaaaaagtaa

DBGET integrated database retrieval system