KEGG   Pectobacterium atrosepticum: ECA1531Help
Entry
ECA1531           CDS       T00186                                 

Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K17950  
L-cysteate sulfo-lyase [EC:4.4.1.25]
Organism
eca  Pectobacterium atrosepticum
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:eca00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1779652..1780665
Genome map
AA seq 337 aa AA seqDB search
MHLARFPRLSLGHFPTPLEVLPNLSAYLGGPTIYIKRDDATGLATGGNKTRKLEFLLADA
QQQGADVIITQGATQSNHVRQTIAAAAKLGLKTKVLLEKRVEDYGEDYQRSGNVLLDNLL
GGDIIDHLPAGTDMQQAMETLAESLRKEGFKPYVIPGGGSSPVGALGYVACAEELLFQSS
QQRLRIDHIVHATGSTGTQAGLVTGLAATHSQIPLLGISVRAPKAKQEENVYALAQRTWQ
LLGIPGELPRSAVRVNSDYVGKGYGIPTEGTLEALRLLAQLEGILLDPVYSGKGMAGLID
LIRQGHFRADENIVFIHTGGSAGLFGYRQLFEQTAAQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcatcttgcccgattcccccgtttatcactgggtcatttccctacgccgttggaagtg
ttgccgaacctgtctgcttatctgggcgggccgacgatttatatcaaacgtgacgatgct
acaggcttggcaactggcgggaataaaacccgcaagctggagttcctgttagccgatgcg
cagcagcagggtgcggacgtcatcatcacacagggcgcgacacagtctaaccatgtgcgg
caaaccattgcggcggcggcaaagctggggctgaaaaccaaagtgctattggaaaagcgc
gtagaggattatggcgaagattatcagcgctccggtaacgtgctgttggataacctgctt
ggcggtgacattatcgatcaccttcctgcgggtacagacatgcagcaggcgatggaaaca
ctggcggaatcgctgcgtaaagaaggatttaagccttatgttatccccggtggcggttcc
agtccggtaggcgcgttgggctatgttgcctgtgcggaagagctgttgttccagtctagc
cagcagcgcttacgcatcgatcatattgtgcatgcgacgggcagcacgggtacgcaggcg
ggattggttactgggctggcggcaacacacagccagatcccgctgttaggcatcagcgtc
agagcgcccaaagcaaagcaggaggagaatgtttacgcgttagcgcagcgcacctggcaa
ctgctgggcattccgggcgaactgccgcgcagcgccgtacgggtgaacagcgactacgtt
ggcaaaggctatggcattcccactgaaggaacgttagaagcgctcaggctgttggcgcag
ttggaagggattttgctcgatccggtctattcaggaaaagggatggcgggactgatcgat
ttaatccgtcaggggcattttcgcgccgatgaaaacatcgtctttattcataccggtggc
tcagcggggctgtttggctaccgccaactgttcgaacaaacggcagcacaatga

DBGET integrated database retrieval system