KEGG   Pectobacterium atrosepticum SCRI1043: ECA1531Help
Entry
ECA1531           CDS       T00186                                 

Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K17950  
L-cysteate sulfo-lyase [EC:4.4.1.25]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ECA1531
Enzymes [BR:eca01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.25  L-cysteate sulfo-lyase
     ECA1531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1779652..1780665
Genome map
AA seq 337 aa AA seqDB search
MHLARFPRLSLGHFPTPLEVLPNLSAYLGGPTIYIKRDDATGLATGGNKTRKLEFLLADA
QQQGADVIITQGATQSNHVRQTIAAAAKLGLKTKVLLEKRVEDYGEDYQRSGNVLLDNLL
GGDIIDHLPAGTDMQQAMETLAESLRKEGFKPYVIPGGGSSPVGALGYVACAEELLFQSS
QQRLRIDHIVHATGSTGTQAGLVTGLAATHSQIPLLGISVRAPKAKQEENVYALAQRTWQ
LLGIPGELPRSAVRVNSDYVGKGYGIPTEGTLEALRLLAQLEGILLDPVYSGKGMAGLID
LIRQGHFRADENIVFIHTGGSAGLFGYRQLFEQTAAQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcatcttgcccgattcccccgtttatcactgggtcatttccctacgccgttggaagtg
ttgccgaacctgtctgcttatctgggcgggccgacgatttatatcaaacgtgacgatgct
acaggcttggcaactggcgggaataaaacccgcaagctggagttcctgttagccgatgcg
cagcagcagggtgcggacgtcatcatcacacagggcgcgacacagtctaaccatgtgcgg
caaaccattgcggcggcggcaaagctggggctgaaaaccaaagtgctattggaaaagcgc
gtagaggattatggcgaagattatcagcgctccggtaacgtgctgttggataacctgctt
ggcggtgacattatcgatcaccttcctgcgggtacagacatgcagcaggcgatggaaaca
ctggcggaatcgctgcgtaaagaaggatttaagccttatgttatccccggtggcggttcc
agtccggtaggcgcgttgggctatgttgcctgtgcggaagagctgttgttccagtctagc
cagcagcgcttacgcatcgatcatattgtgcatgcgacgggcagcacgggtacgcaggcg
ggattggttactgggctggcggcaacacacagccagatcccgctgttaggcatcagcgtc
agagcgcccaaagcaaagcaggaggagaatgtttacgcgttagcgcagcgcacctggcaa
ctgctgggcattccgggcgaactgccgcgcagcgccgtacgggtgaacagcgactacgtt
ggcaaaggctatggcattcccactgaaggaacgttagaagcgctcaggctgttggcgcag
ttggaagggattttgctcgatccggtctattcaggaaaagggatggcgggactgatcgat
ttaatccgtcaggggcattttcgcgccgatgaaaacatcgtctttattcataccggtggc
tcagcggggctgtttggctaccgccaactgttcgaacaaacggcagcacaatga

DBGET integrated database retrieval system