KEGG   Pectobacterium atrosepticum SCRI1043: ECA1588Help
Entry
ECA1588           CDS       T00186                                 

Definition
hypothetical protein
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ECA1588
Enzymes [BR:eca01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     ECA1588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1841727..1842110
Genome map
AA seq 127 aa AA seqDB search
MATPIETVNAFFNAYPEAKGKIAIQRWFTPYSVWVNEGVATTTGVDEAFTLIDKLEEAFG
ITTVRIEMLSIAADGNKVLTERLDRFERADGSEIGAAKVMGILEVEGDKIIAWRDYFDTS
FMQKTAE
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgccgattgagaccgtaaatgcatttttcaacgcttatcctgaagcaaaaggt
aaaattgccatacagcggtggttcacaccctacagcgtctgggtcaatgaaggcgtcgcc
accactaccggcgttgatgaagcgttcacgctgattgataaactcgaagaggcatttggc
atcacgacggtacgtattgaaatgctttcgattgccgctgacggtaataaagtgctcact
gaacggcttgacaggttcgaacgtgctgatggcagcgagattggcgccgcaaaagtgatg
gggatacttgaagtcgagggcgataaaatcatcgcctggagagattactttgatacaagc
ttcatgcagaaaacggctgaatag

DBGET integrated database retrieval system