KEGG   Pectobacterium atrosepticum: ECA1813Help
Entry
ECA1813           CDS       T00186                                 

Gene name
nagZ
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
eca  Pectobacterium atrosepticum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:eca00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:eca00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2057749..2058777
Genome map
AA seq 342 aa AA seqDB search
MGPVMLDVASYELDAEDREVLEHPLVGGVILFTRNFHDVAQLRELVRQIRAASHERLVVS
VDQEGGRVQRFRDGFTRLPAAQAFAALNSVSEAQRLAEEGGWLMAAEMIAMDIDISFAPV
LDIGHQSAAIGERSFHEQPEMALAVAQSFIRGMHSAGMKVTGKHFPGHGAVSADSHKETP
RDPRPLAEIRAHDMLIFKALIQSQQLDAIMPAHVIYTEADPHPASGSSYWLKTVLREELG
FDGIIFSDDLSMEGAAVMGSYPERAQAALQAGCDMILVCNHREGAISVLDNLSPVKAEQL
TRLYHQGSFSRRELLDSPRWKLANQALTSLSERWQAHKNGEK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtgggcccggtaatgttagatgtcgccagctacgagctggatgcagaagatcgtgaagtg
ctggaacatccgctggttggcggcgttattctgttcacccgtaattttcatgatgtggcg
caactacgtgaattagtgcgccaaatccgcgcggcgtcgcatgagcgtcttgtggtttcc
gtggatcaggaaggcgggcgcgttcagcgttttcgtgacgggtttactcggctacctgcc
gcgcaggcatttgctgcattaaatagtgtgtcagaagcccaacggttagcggaagaaggt
ggctggctgatggcggcagaaatgatcgcgatggatatcgacattagttttgcgcccgtg
ttggatatcggtcaccagagtgcggcgattggcgagcgatcgtttcatgaacagccggag
atggcattggctgtagcgcagagttttattcgcggtatgcacagcgcgggcatgaaggtg
acaggtaagcacttccccggtcacggtgcagttagcgccgattcacataaagaaacgccg
cgcgatccgcgcccacttgcggagattcgcgcacacgatatgctgatttttaaagcgctg
atccagagccagcagttggatgcgattatgccagcccatgtgatttacactgaggccgat
ccgcatcctgccagcggttcatcctactggcttaaaacggtactgcgtgaagagctgggt
tttgatggcatcattttctccgacgatctctcgatggaaggtgctgccgtaatgggaagt
tatcccgaaagggcgcaggcggcgttgcaggcggggtgcgacatgattctggtttgcaat
catcgggaaggggccatcagcgtgctggataacctgtccccggtcaaagcggagcaactg
acgcgcttatatcatcagggttcgttttctcgtcgggaactgttggattcgccgcgctgg
aagctggcaaatcaggcgctcacctcactcagtgagcgctggcaggcgcataaaaatggc
gagaaatag

DBGET integrated database retrieval system