KEGG   Pectobacterium atrosepticum: ECA1833Help
Entry
ECA1833           CDS       T00186                                 

Gene name
btuE
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
eca  Pectobacterium atrosepticum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:eca00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:eca00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2079241..2079792
Genome map
AA seq 183 aa AA seqDB search
MSTEIYAIPLTTIDGKATTFEAFKGQVALVVNVASKCGLTKQYDALEKLYETYRDKGLVV
LGFPSNEFAGQEPGSEEEIQEFCRGTFGVQFPMFSKIEVNGENRHPLYQLLIRQQPEANG
TWKSDFFARLVNKGRKPKNPEDILWNFEKFLVDREGRVIERFAPDMSPDHDTIVKAIEAA
LAK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgaaatctatgctattccgctgaccaccatcgacgggaaagcgacaacgttc
gaagcgtttaaagggcaggttgctttagttgtcaacgtcgcatcgaaatgcggcctgact
aaacaatacgacgcgttggaaaaactctacgaaacctatcgtgacaaagggttggtcgtg
ctgggattcccatcaaatgaatttgcgggacaagaaccgggttcagaagaagagattcaa
gaattctgccgtgggacgtttggcgttcagttcccgatgttcagcaagattgaagtgaat
ggcgagaaccgccacccgctgtatcagctgttgattcgccagcaacccgaggccaacggc
acctggaagagtgatttttttgctcgtttggtcaacaaaggccgtaaacccaagaatcca
gaagatattttgtggaacttcgagaagtttctggtcgatcgcgaagggcgcgtgattgag
cgctttgctccggatatgtcgcctgaccatgacactatcgtcaaagcgatagaagcggcg
ttggcaaaataa

DBGET integrated database retrieval system