KEGG   Pectobacterium atrosepticum: ECA1952Help
Entry
ECA1952           CDS       T00186                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
eca  Pectobacterium atrosepticum
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    ECA1952
Enzymes [BR:eca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     ECA1952
Exosome [BR:eca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ECA1952
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2211053..2212543
Genome map
AA seq 496 aa AA seqDB search
MYTPVILAIDEGTTNAKAIAVDERGRILAKAAVALQVTHPQPGRSEQDAMAIWRAVCQAA
EVCLSSLHRAQVVGVAISNQRESVLIWDRQTGKPMTPLVSWQDRRAEKFCQALQGSAEAR
LIESRTGLQVDPLFPAAKLHAMLAELPNGVARAMQGELCIGTVDCWLNWQFSGGRAFSTD
YSNAARTQLFNIHRGCWDEDLLALFGIPSVCLPAVTPSSALHGHTGVTGISGLAACVPIV
ALIGDSHAALYGQGITQSGEIKATYGTGSSLMTTINTPHLHATGLSTTIAWHDGELRYAL
EGNITHTGSGFAWIGQMLGVPSVTQLTELALSAESNQGVFFVPALSGLGAPYWDVQARGL
LCGLCDATTPAIIARAGLEAIAYQVADVFFAMEQVSQAALPALRVDGGATQNRWLMQFQA
DLLQRPLIRNHNAEVSALGAAYLGGKMLGWWEHNEQIAALPREVEVIEPSATNHAILESY
QQWRTAVARARLRPEA
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtatacgccggttattttggcaatcgatgaagggacgacgaacgccaaggcgattgcc
gtcgatgagcgaggacgcattctggctaaagctgccgttgctttgcaggtgacacacccg
caaccgggcagatccgaacaggatgcgatggcgatctggcgtgcggtttgtcaggcggca
gaggtttgcttgtcatcattacaccgtgctcaggtggtgggtgtcgccattagcaatcag
cgtgagtcggtgctgatttgggacaggcaaaccggaaaaccgatgacgccattggtcagt
tggcaggatcgtcgtgcggagaaattctgtcaggcattacaaggaagcgctgaggcacgt
ctgatcgaatcccgtaccggactgcaagtcgatccgctttttcccgccgccaaactgcat
gccatgctggcggaattgccaaacggtgtcgcccgtgcaatgcagggggagttgtgcatc
ggaacggtggattgctggcttaactggcagtttagcggggggcgggcgttctccaccgac
tattccaacgcggcgagaacccaactgtttaatattcaccgcggctgctgggatgaggat
ctgctggcgctgttcggtatccccagcgtttgtctgcctgccgtcacgccttcctcggcg
ttacacggtcacaccggcgtgacgggcatcagtgggcttgccgcttgcgtaccgattgtg
gcgctgattggggattcccatgctgcgctgtacggtcagggcatcacccaaagcggtgaa
atcaaggcgacatacggcaccggttcgtcgctgatgaccaccatcaacacgccgcacctt
cacgccactgggctcagcactacgatcgcttggcacgatggcgaactgcgctacgcgctg
gaaggcaatatcacccataccggctcgggatttgcctggattggtcagatgctgggcgtc
ccttccgttacgcaactgaccgaactggcgctcagcgccgaatcgaatcagggtgttttc
tttgttcctgccttatccgggctaggtgcaccctattgggatgtgcaagcgcgcggcctg
ctgtgtggtttatgcgacgccaccacaccggccatcatcgctcgcgctgggcttgaagcg
attgcgtatcaagttgccgatgtctttttcgctatggaacaggtgtcgcaggccgcttta
cccgctctgcgtgttgacggtggcgcgacgcaaaaccgctggctgatgcagtttcaggct
gacttattacaacgccctctgattcgcaatcacaacgcggaagtatctgcgttgggggcg
gcctatctgggcggcaagatgctgggatggtgggagcataacgaacagatcgccgcgctg
ccgagagaggtggaagtcatcgaaccgtcggcgacaaatcacgccattctggagagctac
caacagtggcgtacggcggtggcgcgagcacgtttgcggcctgaagcatga

DBGET integrated database retrieval system