KEGG   Pectobacterium atrosepticum: ECA1981Help
Entry
ECA1981           CDS       T00186                                 

Gene name
celV
Definition
endoglucanase V (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
eca  Pectobacterium atrosepticum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ECA1981 (celV)
Enzymes [BR:eca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     ECA1981 (celV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2247874..2249394
Genome map
AA seq 506 aa AA seqDB search
MWIRRNKIVRKLTLGVVTTVLGMSLSFSALSATPVETHGQLSIENGRLVDEQGKRVQLRG
ISSNGLQWVGDYVNKDSIKWLRDDWGINVFRVAMYTAENGYIANPSLANKVKEAVAAAQS
LGIYIIIDWHTLSDNDPNTYKAQAKTFFAEMAGLYGNSPNVIYEITNEPNGGVTWNGQIR
PYALDVTDTIRSKDPDNLIIVGSGTWSQDIHDAADNLLPDPNTMYALHFYAGTHGQFLRD
RIDYAQSRGAAIFVSEWGTSDASGNGGPFLPESQTWIDFLNNRGISWVNWSLSDKSETSA
ALTPGASKSGGWTEQNLSTSGKFVREQVRAGADLSGGDTPTTPTEPTNPGNGTTGDVVLQ
YRNVDNNPSDDAIRMAFNIKNTGSTPIKLSDLQVRYYFHDDGKPGANLFVDWANVGPNNI
VTSTGMPAASTDKANRYVLVTFSSGAGSLQPGAETGEVQVRIHAGDWSNVNETNDYSYGA
NVTSYTNWDKITVHDKGTLVWGAEPQ
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgtggatcagaaggaataaaatcgtcaggaaattgacgttaggtgtggtaacaacggtg
ctgggcatgtcgctcagtttctccgcattatccgccacgccggtggaaacacatggccaa
ctgtccatcgaaaatgggcgactggtggatgagcagggaaaaagagtgcaactgagagga
atcagctcgaacgggttgcagtgggttggtgattacgtaaacaaagattcgataaaatgg
ctgcgtgacgactgggggatcaatgtgtttcgcgttgccatgtacacggcggagaatggt
tatattgctaacccttccctcgccaataaggtaaaagaggctgttgcggcggcgcaaagc
cttggcatctacatcattatcgactggcacaccttgtcggataacgatcccaatacttat
aaagcgcaggcaaaaaccttctttgctgaaatggcggggctgtatggtaactcgccgaac
gtgatttatgaaatcaccaatgagccaaacggcggcgtgacgtggaacggacagattcgg
ccttatgcgctggatgttactgacactatccgtagcaaagatcctgataaccttattatc
gtcggcagcgggacctggagccaggacatccatgatgcggcggacaatctgttgcccgat
ccgaatacgatgtacgcgctgcatttctatgccggtacgcacgggcagttcctgcgcgat
cgtatcgattatgcgcaaagccgcggtgccgcaattttcgtcagcgagtgggggacaagc
gatgcgtccggcaatggcgggccgttcctgccagaatcgcaaacctggatcgatttcctg
aataaccgtggcataagctgggtaaactggtcactaagcgataagtctgagacgtctgcg
gcgctgactccaggggcgagtaaatcaggcggttggacggagcagaatctgtcgacgtca
ggaaaatttgtcagagagcaggttcgtgcgggtgcagacctgagtggtggcgatacgccg
accacgccaacggagccgactaacccaggcaatggaacaacgggtgacgtcgtgctgcaa
tatcgtaatgtggataacaacccttccgatgatgcaattcgtatggccttcaacatcaaa
aataccggaagtacgccgatcaaactcagcgatctgcaagtacgttactacttccacgat
gatggtaaaccgggtgcgaacctctttgttgattgggcgaatgtcggccctaacaacatc
gtgaccagcacggggatgcctgccgccagcaccgataaggccaatcgctatgttctggtg
accttcagcagcggagccggttcccttcaaccgggcgcggagaccggtgaggtacaggtc
cgcattcacgctggtgactggagcaacgtgaatgaaacgaatgactattcatacggtgct
aacgtcacgagctacaccaactgggataagatcaccgtgcatgataaaggcacgctggta
tggggcgctgagccgcaatag

DBGET integrated database retrieval system