KEGG   Pectobacterium atrosepticum SCRI1043: ECA2166Help
Entry
ECA2166           CDS       T00186                                 

Gene name
ascB
Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
eca00010  Glycolysis / Gluconeogenesis
eca00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECA2166 (ascB)
   00500 Starch and sucrose metabolism
    ECA2166 (ascB)
Enzymes [BR:eca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     ECA2166 (ascB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: CAG75068
GeneDB: ECA2166
UniProt: Q6D574
Position
2470978..2472408
Genome map
AA seq 476 aa AA seqDB search
MSASTFPTGFLWGGAIAANQAEGAYLEGGKGLTTVDMIPHGVNRLPVKLGQEPRFALRED
EFYPSHQAIDFYHRYKEDIALMAEMGFTVFRTSIAWSRLYPNGDELTPNADGIAFYRDMF
AECKKYNMEPLVTLCHFDVPMHLVTEYGSWRNRKMVEYFTRYARTCFEAFDGLVKYWLTF
NEINILLHSPFSGAGLVFAEGENQEQVKYQAAHHELVASALATKIAHEVNPGNQVGCMLA
GGNFYPWSCKPEDVWAALNKDRENLFFIDVQARGTYPAYTGRLFKEKGITIASEPGDDEI
LKNTVDFVSFSYYASRCASADMNEHNSSAANIVKSLKNPHIKASEWGWGIDPLGLRITMN
MMYDRYQKPLFLVENGLGAKDEINAQGDIDDDYRISYLREHISAMADAIGDGIPVIGYTS
WGCIDLVAASTGEMSKRYGFIYVDRDDLGEGTLARKKKKSFYWYKKVIASNGADLS
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcatcaacatttcccactgggttcttatgggggggcgcgattgcggccaatcag
gcagaaggcgcgtaccttgaaggcggtaaagggctgacgacggtggacatgattccccac
ggcgtgaatcgcctgccggtgaagctaggacaagaaccgcgttttgcgctgcgtgaggat
gagttttatcccagccatcaggcgatcgatttctaccatcgctataaggaagatatcgcg
ctaatggcggaaatggggttcacggtgttccgtacctccatcgcttggagccgtctctat
ccaaacggggatgagctgacgcccaacgcggatggcatcgccttttatcgcgatatgttt
gccgagtgcaagaagtacaacatggaaccgttggtgacgctgtgccatttcgatgtgccg
atgcatttggtcacggaatacggttcatggcgtaaccggaaaatggtggagtacttcacg
cgttacgctcgaacctgttttgaagcgtttgacgggttggtgaaatactggctgacgttc
aacgaaatcaatattttactgcacagcccgttttccggtgcagggctggtatttgccgaa
ggggaaaatcaggaacaggtaaaatatcaggcggcacaccatgaactggtggcgagcgcg
ctggcgacgaagattgcgcatgaggttaacccaggaaatcaggttggctgcatgctggct
ggcggtaatttctatccgtggtcgtgtaaaccggaagatgtctgggcggcgctgaataaa
gatcgtgaaaacctgttctttatcgatgtgcaggcgcgtggcacctatccggcgtatacc
ggacgattgtttaaagagaagggcatcacgattgcttctgagccgggcgatgacgaaatt
ctcaagaacacggtggattttgtttccttcagttattacgcctcccgctgcgcgtcggca
gatatgaacgagcacaacagtagcgccgcgaacatcgttaaatcgctgaagaacccgcac
atcaaggcgagtgaatggggctgggggattgatccgctgggcctgcgcatcacgatgaac
atgatgtatgaccgttatcagaaaccgctgtttttggtggagaatggattaggggcgaag
gacgagattaacgcgcagggcgacattgatgatgactaccgcatcagctatctgcgtgag
cacatcagcgcgatggcagacgccatcggcgacggtattccggttatcggctacacctcg
tggggctgtatcgatctggttgccgcgtctaccggcgagatgagtaaacgctatggcttc
atctatgtcgatcgcgacgacctaggcgaagggacattagccagaaagaaaaagaaatcg
ttctactggtataaaaaggtgatcgccagcaacggcgctgacctgagctga

DBGET integrated database retrieval system