KEGG   Pectobacterium atrosepticum: ECA2166Help
Entry
ECA2166           CDS       T00186                                 

Gene name
ascB
Definition
cryptic 6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
eca  Pectobacterium atrosepticum
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECA2166 (ascB)
Enzymes [BR:eca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     ECA2166 (ascB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2470978..2472408
Genome map
AA seq 476 aa AA seqDB search
MSASTFPTGFLWGGAIAANQAEGAYLEGGKGLTTVDMIPHGVNRLPVKLGQEPRFALRED
EFYPSHQAIDFYHRYKEDIALMAEMGFTVFRTSIAWSRLYPNGDELTPNADGIAFYRDMF
AECKKYNMEPLVTLCHFDVPMHLVTEYGSWRNRKMVEYFTRYARTCFEAFDGLVKYWLTF
NEINILLHSPFSGAGLVFAEGENQEQVKYQAAHHELVASALATKIAHEVNPGNQVGCMLA
GGNFYPWSCKPEDVWAALNKDRENLFFIDVQARGTYPAYTGRLFKEKGITIASEPGDDEI
LKNTVDFVSFSYYASRCASADMNEHNSSAANIVKSLKNPHIKASEWGWGIDPLGLRITMN
MMYDRYQKPLFLVENGLGAKDEINAQGDIDDDYRISYLREHISAMADAIGDGIPVIGYTS
WGCIDLVAASTGEMSKRYGFIYVDRDDLGEGTLARKKKKSFYWYKKVIASNGADLS
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcatcaacatttcccactgggttcttatgggggggcgcgattgcggccaatcag
gcagaaggcgcgtaccttgaaggcggtaaagggctgacgacggtggacatgattccccac
ggcgtgaatcgcctgccggtgaagctaggacaagaaccgcgttttgcgctgcgtgaggat
gagttttatcccagccatcaggcgatcgatttctaccatcgctataaggaagatatcgcg
ctaatggcggaaatggggttcacggtgttccgtacctccatcgcttggagccgtctctat
ccaaacggggatgagctgacgcccaacgcggatggcatcgccttttatcgcgatatgttt
gccgagtgcaagaagtacaacatggaaccgttggtgacgctgtgccatttcgatgtgccg
atgcatttggtcacggaatacggttcatggcgtaaccggaaaatggtggagtacttcacg
cgttacgctcgaacctgttttgaagcgtttgacgggttggtgaaatactggctgacgttc
aacgaaatcaatattttactgcacagcccgttttccggtgcagggctggtatttgccgaa
ggggaaaatcaggaacaggtaaaatatcaggcggcacaccatgaactggtggcgagcgcg
ctggcgacgaagattgcgcatgaggttaacccaggaaatcaggttggctgcatgctggct
ggcggtaatttctatccgtggtcgtgtaaaccggaagatgtctgggcggcgctgaataaa
gatcgtgaaaacctgttctttatcgatgtgcaggcgcgtggcacctatccggcgtatacc
ggacgattgtttaaagagaagggcatcacgattgcttctgagccgggcgatgacgaaatt
ctcaagaacacggtggattttgtttccttcagttattacgcctcccgctgcgcgtcggca
gatatgaacgagcacaacagtagcgccgcgaacatcgttaaatcgctgaagaacccgcac
atcaaggcgagtgaatggggctgggggattgatccgctgggcctgcgcatcacgatgaac
atgatgtatgaccgttatcagaaaccgctgtttttggtggagaatggattaggggcgaag
gacgagattaacgcgcagggcgacattgatgatgactaccgcatcagctatctgcgtgag
cacatcagcgcgatggcagacgccatcggcgacggtattccggttatcggctacacctcg
tggggctgtatcgatctggttgccgcgtctaccggcgagatgagtaaacgctatggcttc
atctatgtcgatcgcgacgacctaggcgaagggacattagccagaaagaaaaagaaatcg
ttctactggtataaaaaggtgatcgccagcaacggcgctgacctgagctga

DBGET integrated database retrieval system