KEGG   Pectobacterium atrosepticum SCRI1043: ECA2299Help
Entry
ECA2299           CDS       T00186                                 

Gene name
trpC
Definition
(GenBank) tryptophan biosynthesis protein [includes: indole-3-glycerol phosphate synthase and N-(5'-phospho-ribosyl)anthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
eca00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eca01100  Metabolic pathways
eca01110  Biosynthesis of secondary metabolites
eca01130  Biosynthesis of antibiotics
eca01230  Biosynthesis of amino acids
Module
eca_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ECA2299 (trpC)
Enzymes [BR:eca01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     ECA2299 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     ECA2299 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-ProteinID: CAG75202
GeneDB: ECA2299
UniProt: Q6D4U1
Position
2606188..2607555
Genome map
AA seq 455 aa AA seqDB search
MQETVLHKIVRDKALWVAEREKAQPLASFQHEIVPSQRDFYQALKQDKPAFILECKKASP
SKGLIRDDFDPVAIAQVYKDYASAISVLTDEKYFQGDFAFLPQVSAAVHQPVLCKDFIIS
PYQIYLARYYQADAILLMLSVLDDEQYQQLAEVAHSLKLGVLTEVSNEEELLRAIQLEAR
VVGINNRDLRDLSIDLNRTRTLAPRLPAGVTVISESGINCQAQIRELSAFAQGFLIGSSL
MSEPDLNGAVRRVILGENKVCGLTRAADAQAAYHAGALYGGLIFVASSPRYIDAKQAADV
IEGAPLRYVGVFRNAPVAHIVAITTQLGLAAVQLHGDEDQQTIDQLRQQLPATCQIWKAL
SITDVLPERNLTHVDRYVFDNGQGGSGKTFNWSLLDNQSLDNVLLAGGLNSDNCALAARQ
GCAGLDFNSGVESEPGKKDSHKIAAVFATLRQQQH
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaaccgtattacataaaattgtgcgtgataaagcgctctgggttgcggaacga
gaaaaagcacagccgctggcctcttttcagcatgagatcgttcccagccagcgcgacttt
tatcaggcgctgaaacaagataagcccgcctttattcttgaatgcaaaaaggcgtcaccg
tcgaagggattgattcgcgatgatttcgacccggtagcgatagctcaggtctataaagat
tacgcgtctgctatttccgttttgactgacgaaaagtattttcagggcgattttgccttc
ctgccgcaggttagcgcggcagtccatcagccggtgttgtgcaaagactttattatttcg
ccctaccagatctatctggcacgctactatcaggccgatgccattctgctgatgctatcc
gtgctggacgacgagcaatatcagcaactggccgaagtggcgcacagcctgaagctgggc
gtgttgacagaagttagtaatgaagaagagctgctgcgggccattcagctcgaagcacgc
gtcgttgggatcaacaaccgcgacctgcgcgatctctccattgacctcaaccgtacccgg
acgctcgcaccgcgtctgcctgctggcgtcaccgtgatcagcgaatccggtatcaactgc
caggcacagattcgtgaactcagcgcttttgctcagggcttcctgatcggcagttcactg
atgtctgaaccggatctgaacggcgcggtacgccgcgttattctgggtgaaaacaaggtc
tgcggcctgacgcgcgcagctgatgcacaggccgcctatcatgcgggtgcgctctacggc
ggtttaatcttcgtcgccagttctccacgctatatcgacgccaaacaagcggccgatgtc
attgagggtgcgccactgcgttatgtcggcgttttccgcaatgcgcccgtcgctcatatc
gttgctatcacgacgcagttggggttagcggctgttcaactacatggcgatgaggatcaa
cagacgatcgaccagctacgccagcaattacctgcaacgtgccagatttggaaagcactg
agcatcacggatgtgctgccagagcgtaatctcactcacgtcgatcgctacgtgtttgac
aacggtcagggcggcagcggtaaaaccttcaactggtcgctgctggacaatcagtcactg
gataacgtgctgttagccggtggactgaatagcgataactgcgcactggcggcacggcaa
ggttgcgcaggactggatttcaattccggggtggaaagcgaaccggggaaaaaagattca
cataaaattgctgccgtttttgcgacgttacgtcagcagcaacactaa

DBGET integrated database retrieval system