KEGG   Pectobacterium atrosepticum SCRI1043: ECA2300Help
Entry
ECA2300           CDS       T00186                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ECA2300 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECA2300 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ECA2300 (trpB)
Enzymes [BR:eca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ECA2300 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
GeneDB: 
UniProt: 
Position
2607572..2608762
Genome map
AA seq 396 aa AA seqDB search
MTLLNPYFGEFGGQFVPQILIPALRQLEEAFVSAQKDPEFQAEFTDLLKNYAGRPTALTL
CKNLTAGTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGAGQHGVATAL
ACALLGLKCRVYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSSTLKDACNEALRDWSGSY
ETAHYLLGTAAGPHPYPTIVREFQRMIGEETKAQILEKEGRLPDAVLACVGGGSNAIGMF
ADFIDDTHVRLIGIEPGGLGIESGQHGAPLKHGRVGIYFGMKSPMMQTSDGQIEESYSIS
AGLDFPSVGPQHAYLNSIGRADYVSITDDEALDAFKALCRGEGIIPALESSHALAHALKM
IKAEPEKEQLLVVNLSGRGDKDIFTVHDILKDRGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacattactcaacccttatttcggtgaattcggcggacagtttgttccgcagatcctc
atcccggcgttgcgccagctggaagaggctttcgtcagcgcacaaaaagatcctgaattt
caggctgaatttaccgatctgctgaaaaactatgcgggtcgcccgacagcattaacccta
tgcaaaaacctgacggctgggacgaaaaccaagctgtacctgaagcgtgaagatctgctg
cacggcggcgcgcacaaaacgaatcaggtgcttggacaggcattgctggctaagcgcatg
ggtaaaagtgaaatcatcgctgaaaccggtgcgggacaacacggcgtcgcgacggcgctg
gcttgcgccctgcttggcctgaaatgccgcgtttatatgggtgcaaaagacgttgagcgt
cagtcgccgaacgtcttccgcatgcgcttgatgggtgcagaagtgattccagttcatagc
ggttcttccacgctgaaagatgcctgtaacgaagcgctgcgtgactggtctggcagctat
gaaacggcacactatctgctgggaacggcggcaggtccgcacccttacccaactatcgta
cgcgaattccaacgtatgattggtgaagagacgaaagcgcagatcctggaaaaagaaggt
cgcttgccggatgcggtgctggcctgtgtcggcggcggctctaacgcaattggcatgttc
gctgatttcatcgacgatactcacgttcgcctgatcggcattgagccgggcggcttaggc
attgaatctgggcagcacggtgcaccgttaaagcatggccgcgtcggtatttatttcggt
atgaagtccccgatgatgcaaacatctgacggacaaattgaagagtcctattctatttcc
gctgggctggatttcccatccgtagggccgcagcacgcctacctgaacagcatcggccgt
gcagactatgtctcgattaccgatgatgaagcgctggatgccttcaaagcgctctgccgc
ggtgaaggtattatccctgcactggaatcctcccatgcgctggcacacgccttgaagatg
atcaaagcggagccggagaaagagcaactgctggtggtcaacctgtccggacgtggtgat
aaagacatctttaccgtgcacgatattttgaaagatcggggagaaatctaa

DBGET integrated database retrieval system