KEGG   Pectobacterium atrosepticum SCRI1043: ECA2301Help
Entry
ECA2301           CDS       T00186                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ECA2301 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECA2301 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ECA2301 (trpA)
Enzymes [BR:eca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ECA2301 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2608762..2609568
Genome map
AA seq 268 aa AA seqDB search
MERYQQLFTRLSEKKEGAFVPFVTLGDPSPEQSLKIIDTLIAAGADALELGVPFSDPLAD
GPTIQDANLRAFAAGVTSGQCFEMLAAIRQKYPEIPIGLLMYANLVFSNGIDEFYQRCAE
VGVDSVLVADVPVVESAAFRAAALRHGIAPIFICPPNADDELLREIASYGRGYTYLVSRA
GVTGAEKRAQLPLNHLVAKLNEYHAAPPLQGFGISDPAQVRETVASGAAGAISGSAIVRI
IEKNLNQPDVMLSELHAFVSEMKAATRS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggagcgctatcaacagttgtttacacgcctgtcagagaaaaaagaaggcgcgttcgtc
ccctttgtcacgctaggcgatccgtcccccgagcagtcactgaagattatcgatacgttg
attgccgccggtgccgatgcgctagagttgggggtccccttctctgacccgctagcggac
ggcccaaccattcaggatgctaacctgcgcgcctttgccgcaggcgtcacgtcagggcaa
tgtttcgaaatgctggcggccatacgccagaaatacccggaaattccaatcggcctgctg
atgtatgccaatctggttttcagcaacggcattgatgaattttatcagcgctgtgcagag
gttggcgtcgattcggttttagtggcagatgtcccggtggtcgagtcagccgctttccgt
gccgcagcgctgcggcacggtattgcccctatatttatctgtccacccaatgctgatgat
gaactgctgcgagagatcgcctcttatggccgtggctatacctatctggtttcacgcgcg
ggcgtgacgggggcagaaaaacgtgctcagttgccgctgaatcatctggttgccaaactg
aacgagtatcacgctgctccgccactacaaggatttggcatttctgatcctgcccaagtg
cgtgaaacagtagcgtcaggtgcagcgggggccatttctggctctgccatcgtccggatt
atcgaaaaaaatctgaaccagcctgatgtcatgctgtcagagttacacgcctttgtgagt
gaaatgaaagcggctacacgttcataa

DBGET integrated database retrieval system