KEGG   Pectobacterium atrosepticum SCRI1043: ECA2301Help
Entry
ECA2301           CDS       T00186                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
eca00260  Glycine, serine and threonine metabolism
eca00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eca01100  Metabolic pathways
eca01110  Biosynthesis of secondary metabolites
eca01130  Biosynthesis of antibiotics
eca01230  Biosynthesis of amino acids
Module
eca_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECA2301 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ECA2301 (trpA)
Enzymes [BR:eca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ECA2301 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA
Motif
Other DBs
NCBI-ProteinID: CAG75204
GeneDB: ECA2301
UniProt: Q6D4T9
Position
2608762..2609568
Genome map
AA seq 268 aa AA seqDB search
MERYQQLFTRLSEKKEGAFVPFVTLGDPSPEQSLKIIDTLIAAGADALELGVPFSDPLAD
GPTIQDANLRAFAAGVTSGQCFEMLAAIRQKYPEIPIGLLMYANLVFSNGIDEFYQRCAE
VGVDSVLVADVPVVESAAFRAAALRHGIAPIFICPPNADDELLREIASYGRGYTYLVSRA
GVTGAEKRAQLPLNHLVAKLNEYHAAPPLQGFGISDPAQVRETVASGAAGAISGSAIVRI
IEKNLNQPDVMLSELHAFVSEMKAATRS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggagcgctatcaacagttgtttacacgcctgtcagagaaaaaagaaggcgcgttcgtc
ccctttgtcacgctaggcgatccgtcccccgagcagtcactgaagattatcgatacgttg
attgccgccggtgccgatgcgctagagttgggggtccccttctctgacccgctagcggac
ggcccaaccattcaggatgctaacctgcgcgcctttgccgcaggcgtcacgtcagggcaa
tgtttcgaaatgctggcggccatacgccagaaatacccggaaattccaatcggcctgctg
atgtatgccaatctggttttcagcaacggcattgatgaattttatcagcgctgtgcagag
gttggcgtcgattcggttttagtggcagatgtcccggtggtcgagtcagccgctttccgt
gccgcagcgctgcggcacggtattgcccctatatttatctgtccacccaatgctgatgat
gaactgctgcgagagatcgcctcttatggccgtggctatacctatctggtttcacgcgcg
ggcgtgacgggggcagaaaaacgtgctcagttgccgctgaatcatctggttgccaaactg
aacgagtatcacgctgctccgccactacaaggatttggcatttctgatcctgcccaagtg
cgtgaaacagtagcgtcaggtgcagcgggggccatttctggctctgccatcgtccggatt
atcgaaaaaaatctgaaccagcctgatgtcatgctgtcagagttacacgcctttgtgagt
gaaatgaaagcggctacacgttcataa

DBGET integrated database retrieval system