KEGG   Pectobacterium atrosepticum: ECA2326Help
Entry
ECA2326           CDS       T00186                                 

Gene name
adhE
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
eca  Pectobacterium atrosepticum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ECA2326 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECA2326 (adhE)
   00620 Pyruvate metabolism
    ECA2326 (adhE)
   00650 Butanoate metabolism
    ECA2326 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    ECA2326 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    ECA2326 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ECA2326 (adhE)
   00626 Naphthalene degradation
    ECA2326 (adhE)
Enzymes [BR:eca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ECA2326 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     ECA2326 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2634501..2637176
Genome map
AA seq 891 aa AA seqDB search
MAVTNVAELNALVERVKKAQQEFATYTQEQVDKIFRAAALAASDARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYQDEKTCGVLSTDDTFGTITIAEPIGLICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKNATNKAADIVLQAAIAAGAPKDIIGWIDQPSVDLSNQ
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASILMSKTF
DNGVICASEQSVIVVDSAYDAVRERFATHGGYMLKGKELHAVQGILLKNGSLNADIVGQP
APKIAEMAGITVPANTKVLIGEVTAVDESEPFAHEKLSPTLAMYRAKDFNDAVIKAEKLV
AMGGIGHTSCLYTDQDNQPERVNHFGNMMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALEEVASDGAK
RAFIVTDRFLFNNGYVDQVTSVLKQHGLETEVFFEVEADPTLSIVRKGAEQMHSFKPDVI
IALGGGSPMDAAKIMWVMYEHPTTHFEELALRFMDIRKRIYKFPKMGVKAKMVAITTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMNMPKSLCAFGGLDAVTHSLE
AYVSVLANEYSDGQALQALKLLKENLPDSYRDGAKNPVARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANAMLISNVIRYNANDNPTKQTTFSQYDRPQARRRYAEIAD
HLRLTAPSDRTAQKIEKLLNWLEEIKTELGIPASIREAGVQEADFLAKVDKLSEDAFDDQ
CTGANPRYPLISELKQILLDTYYGRKFSEEVKTETVEPVAKAAKTGKKAAH
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atggccgtaaccaacgttgctgaacttaacgcactggtcgaaagagttaaaaaggcacag
caggaatttgccacttacactcaggaacaagtggacaagatcttccgcgctgccgcactc
gctgcatcggatgcccgtatcccgctggcaaaaatggcggttgctgaatccggtatgggg
atcgtggaagataaagtcatcaaaaaccacttcgcatccgaatacatttataacgcctat
caggatgaaaaaacctgtggcgtcctctctactgatgacactttcggtactattaccatt
gcagagcctattggcctgatttgcggtattgttcccaccaccaaccccacttctaccgcg
atttttaaagcgctgatcagcctgaagactcgtaacgggattatcttctctccccatcca
cgtgcaaaaaatgcgaccaataaagccgcagacattgtactgcaagctgcgattgccgct
ggcgccccgaaagatatcatcggctggattgatcaaccgtccgtcgatttatccaaccaa
ctgatgcaccacccagatatcaacctgattctggctaccggcgggccgggtatggtgaaa
gcggcatacagctcaggtaaaccggcgatcggcgtaggtgcaggtaacacccccgttgtt
attgacgaaacggcggatattaagcgtgccgttgcctctatcctgatgtcgaaaaccttc
gataacggcgtcatttgtgcgtcagaacagtcagtcatcgtggtagacagcgcctatgat
gccgtacgtgagcgtttcgccacccacggcggctacatgctgaaaggcaaagaacttcat
gccgtacaaggcattctgctgaaaaacggctcactgaatgccgacattgtgggccagcca
gcaccaaagatcgctgaaatggcgggtatcaccgtccctgcgaacaccaaagtgctgatc
ggtgaagtgacggccgttgatgaatccgaaccgtttgcccatgaaaaactgtctccgacg
ctggcgatgtaccgggcgaaagacttcaatgacgccgtcattaaagcggaaaaactggtg
gcaatgggtggcatcggtcacacatcctgcctgtataccgatcaggacaatcagccagag
cgtgtaaatcatttcgggaatatgatgaaaacggcacgtatcctgattaacacgccggct
tctcagggtggtatcggcgatctctacaacttcaaactcgctccgtctctgacactgggc
tgtggctcatggggcggaaactccatctccgaaaacgtcggtccgaagcacttgatcaac
aaaaaaacggtagccaagcgagcagagaatatgttgtggcataaacttcctaaatccatt
tacttccgtcgtggctcactgcctatcgcacttgaagaagtcgcatccgatggtgcaaaa
cgcgcatttatcgtgactgaccgcttcctgttcaataatggctacgttgatcaggtaact
tccgtactgaaacaacacggactggaaaccgaagttttctttgaagttgaagctgacccg
acactgagcatcgtgcgcaaaggcgcggaacaaatgcactccttcaagcccgatgtgatt
attgcactgggtggcggttctccgatggatgctgcgaagatcatgtgggtgatgtatgag
caccctactacacacttcgaagagctggcgctgcgctttatggatatccgtaaacgtatc
tataagttcccgaaaatgggtgtcaaagccaagatggtggcgattaccactacatccggt
actggttccgaagtcacgccatttgccgtggtgaccgacgatgcaactggacagaaatat
ccgttggcggactatgcgctgaccccagatatggccattgttgatgccaatctggtgatg
aacatgccgaaatcgctgtgtgcctttggtgggctcgatgccgtaacccactcgctggaa
gcctatgtttccgtgctggcaaatgaatattcagacggacaggcgttacaagcgctgaaa
ctgctgaaggaaaatctgccggacagctaccgtgacggtgcgaaaaacccggttgcccgt
gagcgcgtgcacaacgccgcgacgattgcgggtatcgcgtttgccaacgccttcctcggc
gtctgtcactcaatggcgcataaactgggctcggagttccatattccgcacggtctggct
aatgccatgctgatctcgaacgtgattcgctataacgcgaacgataacccgaccaaacaa
acaacgttcagccaatatgaccgtccgcaagctcgtcgtcgttacgctgaaatagccgac
cacctacgtttgactgcgcctagcgaccgtactgcacagaaaatcgagaaattactgaac
tggctggaagaaataaagaccgaactggggatcccagcgtccattcgtgaagcgggcgta
caggaggccgatttcctggctaaggtcgataaactgtcagaagatgcgttcgacgatcag
tgtactggtgctaacccacgctacccgctgatttctgaattgaaacagattctgctggac
acttactatggtcgtaagttctctgaagaggtaaaaacggaaaccgttgaacctgtagca
aaagccgccaaaaccggcaagaaagccgcacattaa

DBGET integrated database retrieval system