KEGG   Pectobacterium atrosepticum SCRI1043: ECA2329Help
Entry
ECA2329           CDS       T00186                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
eca00040  Pentose and glucuronate interconversions
eca00052  Galactose metabolism
eca00500  Starch and sucrose metabolism
eca00520  Amino sugar and nucleotide sugar metabolism
eca01100  Metabolic pathways
eca01130  Biosynthesis of antibiotics
Module
eca_M00362  Nucleotide sugar biosynthesis, prokaryotes
eca_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECA2329 (galU)
   00052 Galactose metabolism
    ECA2329 (galU)
   00500 Starch and sucrose metabolism
    ECA2329 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    ECA2329 (galU)
Enzymes [BR:eca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ECA2329 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: CAG75232
GeneDB: ECA2329
UniProt: Q6D4R1
Position
complement(2638855..2639766)
Genome map
AA seq 303 aa AA seqDB search
MSIVNKKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIILV
THSSKNSIENHFDTSFELEAILEKRVKRQLLEEIQSICPKHVTIMQVRQGLAKGLGHAVL
CAHPLVGDEPVAVILPDVIIDEYESDLKKDNLSEMLQRFSTTGHSQIMVEPVENVSSYGV
VDCKGVELKAGDSAPMVGVVEKPKASEAPSNLAVVGRYVLSADIWSLLEKTPPGAGNEIQ
LTDAIAMLMEKETVEAYHLKGVSHDCGNKLGYMQAFVEYGLRHDGLGEEFAQWLQEAIDA
EEK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtctattgtgaataaaaaagtaaaaaaagcggtcataccggttgctggattaggtacg
cgtatgctgcctgccaccaaagccattcctaaagaaatgctgccgttggtagataaaccg
ctgatccaatatgtcgttaatgagtgtatcgccgcagggattaatgaaattatcctggtt
acgcactcctctaagaattccatcgaaaaccatttcgataccagttttgaactcgaagcc
atactggaaaagcgtgttaaacgtcagctgttggaagaaattcaatccatctgccctaaa
cacgtcaccattatgcaagtccgtcagggattagcgaaagggttgggccatgccgtattg
tgcgcgcacccgctagtcggggatgagccagtcgcggttattctgccggatgtgattatt
gatgaatatgaatccgatctgaagaaagataacctgagcgaaatgctacagcgtttttct
actacaggtcacagtcagattatggttgagccggttgagaatgtaagtagctacggcgtg
gttgattgcaaaggcgtggaattaaaagcaggggatagcgcacctatggttggtgtggtt
gaaaaaccgaaagcttccgaagcgccgtctaatttagctgttgttggccgttatgtactc
tcagcggatatttggtctctgctggagaaaacaccaccaggcgctggtaatgaaattcag
ttaaccgatgctattgcgatgctgatggaaaaagaaacagtagaagcgtatcacctgaaa
ggtgtgagccatgactgtggtaacaaattaggctatatgcaggcatttgtggaatatggc
ttacgtcatgatggtttaggcgaagagttcgcgcaatggttgcaggaagcgattgacgca
gaagaaaaataa

DBGET integrated database retrieval system