KEGG   Pectobacterium atrosepticum SCRI1043: ECA2329Help
Entry
ECA2329           CDS       T00186                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase subunit GalU (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECA2329 (galU)
   00052 Galactose metabolism
    ECA2329 (galU)
   00500 Starch and sucrose metabolism
    ECA2329 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    ECA2329 (galU)
Enzymes [BR:eca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ECA2329 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(2638855..2639766)
Genome map
AA seq 303 aa AA seqDB search
MSIVNKKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIILV
THSSKNSIENHFDTSFELEAILEKRVKRQLLEEIQSICPKHVTIMQVRQGLAKGLGHAVL
CAHPLVGDEPVAVILPDVIIDEYESDLKKDNLSEMLQRFSTTGHSQIMVEPVENVSSYGV
VDCKGVELKAGDSAPMVGVVEKPKASEAPSNLAVVGRYVLSADIWSLLEKTPPGAGNEIQ
LTDAIAMLMEKETVEAYHLKGVSHDCGNKLGYMQAFVEYGLRHDGLGEEFAQWLQEAIDA
EEK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtctattgtgaataaaaaagtaaaaaaagcggtcataccggttgctggattaggtacg
cgtatgctgcctgccaccaaagccattcctaaagaaatgctgccgttggtagataaaccg
ctgatccaatatgtcgttaatgagtgtatcgccgcagggattaatgaaattatcctggtt
acgcactcctctaagaattccatcgaaaaccatttcgataccagttttgaactcgaagcc
atactggaaaagcgtgttaaacgtcagctgttggaagaaattcaatccatctgccctaaa
cacgtcaccattatgcaagtccgtcagggattagcgaaagggttgggccatgccgtattg
tgcgcgcacccgctagtcggggatgagccagtcgcggttattctgccggatgtgattatt
gatgaatatgaatccgatctgaagaaagataacctgagcgaaatgctacagcgtttttct
actacaggtcacagtcagattatggttgagccggttgagaatgtaagtagctacggcgtg
gttgattgcaaaggcgtggaattaaaagcaggggatagcgcacctatggttggtgtggtt
gaaaaaccgaaagcttccgaagcgccgtctaatttagctgttgttggccgttatgtactc
tcagcggatatttggtctctgctggagaaaacaccaccaggcgctggtaatgaaattcag
ttaaccgatgctattgcgatgctgatggaaaaagaaacagtagaagcgtatcacctgaaa
ggtgtgagccatgactgtggtaacaaattaggctatatgcaggcatttgtggaatatggc
ttacgtcatgatggtttaggcgaagagttcgcgcaatggttgcaggaagcgattgacgca
gaagaaaaataa

DBGET integrated database retrieval system