KEGG   Pectobacterium atrosepticum SCRI1043: ECA2352Help
Entry
ECA2352           CDS       T00186                                 

Definition
(GenBank) putative 6-phosphofructokinase isozyme II
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
eca00010  Glycolysis / Gluconeogenesis
eca00030  Pentose phosphate pathway
eca00051  Fructose and mannose metabolism
eca00052  Galactose metabolism
eca00680  Methane metabolism
eca01100  Metabolic pathways
eca01110  Biosynthesis of secondary metabolites
eca01120  Microbial metabolism in diverse environments
eca01130  Biosynthesis of antibiotics
eca01200  Carbon metabolism
eca01230  Biosynthesis of amino acids
eca03018  RNA degradation
Module
eca_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECA2352
   00030 Pentose phosphate pathway
    ECA2352
   00051 Fructose and mannose metabolism
    ECA2352
   00052 Galactose metabolism
    ECA2352
  Energy metabolism
   00680 Methane metabolism
    ECA2352
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    ECA2352
Enzymes [BR:eca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ECA2352
Protein phosphatases and associated proteins [BR:eca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ECA2352
Messenger RNA biogenesis [BR:eca03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     ECA2352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat DUF1357_C
Motif
Other DBs
NCBI-ProteinID: CAG75255
GeneDB: ECA2352
UniProt: Q6D4N8
Position
2665344..2666324
Genome map
AA seq 326 aa AA seqDB search
MKIGLVISGGDVSGINNFIFQVNRMTASDIVIFDGGINGLIDNCCKVLTRRDLVDYSLSS
MPLVTSGRKTGKCRKTDYEKIVKNIQKQKLDALIMAGGDGSFQFLKKLSCYGIHCYGIGM
TIDNDISGNSYTIGFSTACEQVMSEVEKLRNTGRGLQGRVFMIELLGGYCGELTLQAALK
SNADIALIPESPWDIDALSQCILDKIAEQNSVIILCSEGYTHEYTPGFQGAIDTIIKKLE
HKIGIRIRKTILGYGLRNGAPTGEEIIQGTLLAEEVVRCINAGLTNKIIIINNNNKAIPI
DLEDSERRLVDIESHFYKLAKSHHLI
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggactagttattagcggcggcgatgttagcggaataaataacttcatcttc
caggtgaatagaatgactgcctctgacatcgtcattttcgatggtggaattaatggcctt
atcgataactgctgtaaagttctcacccgccgcgatctggtggattattcactctcatca
atgcccttggttacatcagggagaaaaaccgggaaatgtagaaaaacagactacgagaaa
atcgtcaaaaatatccaaaaacaaaagctcgacgcgctcattatggccggtggagatggc
tcgttccaatttctaaaaaaattaagttgctatggtatccattgctacggtataggaatg
acgattgataatgatatctcaggaaatagctatacgattggtttttctaccgcctgcgaa
caggtaatgagtgaagtggaaaaattgcgcaatacgggccgtggattgcaaggtcgggta
ttcatgattgaattactcggtggttattgcggcgagttaacattacaggcggcattaaag
agcaatgcagacatcgcactcattccggagtcaccgtgggatattgatgcattatcacag
tgtattttggataaaatcgcagaacaaaacagcgtgatcattttatgctctgaaggctac
acccatgaatatacccccggctttcagggcgctatcgacactattatcaagaaactcgaa
cataagattggaatccgtatccgaaaaaccattttaggatatggcttacgaaatggcgcg
cccaccggggaagaaattattcagggcaccctgttagcagaagaagtggttcggtgtatt
aatgccggactgactaataagatcatcattatcaataataacaacaaagcgattcctatc
gacttggaggactctgaacgacgtttggttgatatcgaaagtcatttttataagctcgcg
aaatctcatcatcttatatga

DBGET integrated database retrieval system