KEGG   Pectobacterium atrosepticum SCRI1043: ECA2711Help
Entry
ECA2711           CDS       T00186                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
eca00790  Folate biosynthesis
eca01100  Metabolic pathways
Module
eca_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ECA2711 (folE)
Enzymes [BR:eca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     ECA2711 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: CAG75611
GeneDB: ECA2711
UniProt: Q6D3N3
Position
complement(3045672..3046334)
Genome map
AA seq 220 aa AA seqDB search
MSSLSKEAVMVHEALLARGLETPLRGALLDRDTRKQRIAEHMTEIMNLLSLDLGDDSLAE
TPTRIAKMYVDEIFSGLDYANFPKITIIENKMKVDEMVTVRDITLTSTCEHHFVMIDGKA
TVAYIPKDGVIGLSKLNRIVQFFSQRPQVQERLTQQILVALQTLLGTNNVAVSIDAVHYC
VKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHN
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcactaagtaaagaagccgttatggtgcacgaagcgctgctggcacgcggtctg
gaaacgccgctgcgtggggcgttgttggatcgggatacgcgtaagcaacgtattgccgag
catatgacggaaattatgaatttgctgagcctcgatctgggcgatgacagcctggctgaa
acaccgactcgtatcgccaaaatgtacgttgatgaaatattctccggtttggactacgcc
aacttccccaaaatcaccatcattgaaaacaaaatgaaggtcgatgaaatggtcaccgtg
cgtgatatcacattgaccagcacctgcgaacaccatttcgtgatgatcgatgggaaagct
acggtggcgtatattccaaaagatggcgtcattggcttgtcgaagctcaaccgaatcgtt
cagtttttctctcagcgtcctcaggtgcaggagcgcttaactcagcagattttggttgcg
ctgcaaacgctgttgggaacaaacaatgttgcggtctcgattgatgcagtgcactactgc
gtgaaggcacgcggtattcgtgatgcgactagcgcaacgaccacgacatcgttaggcgga
ctgtttaaatccagccagaacacgcgtcaggaattcttgcgcgcggtacgccaccacaat
taa

DBGET integrated database retrieval system