KEGG   Pectobacterium atrosepticum SCRI1043: ECA3179Help
Entry
ECA3179           CDS       T00186                                 

Gene name
pbg
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ECA3179 (pbg)
Enzymes [BR:eca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     ECA3179 (pbg)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
3551956..3554016
Genome map
AA seq 686 aa AA seqDB search
MFKFPPLSSKVPVLLHGADYNPDQWLDNPEVLEKDIEMMKQTQCNVMSVGIFSWSGIEPE
EGRYEFGWLDSILNTLYANGIFVFLATPSGARPAWLSQKYPDVLRVGSNRVQALHGGRHN
HCLSSPNYREKVKQMNTQLAKRYSHHPAVIGWHISNEYSGECHCDTCRSTFQSWLKARYG
TIEALNKAWWSTFWSHTYTDWSQLEPPSPIGEVSIHGLNLDWKRFNTSQVSDFCAAEIAP
LKAENPSLPTTTNFMEYFYDYDYWQLAKVIDFISWDSYPLWHNAEDDCTLGAYTAMYHDL
MRTLKGGKPFYLMESTPSLTNWQPISKLKKPGMHILSSLQAVAHGSDSVQYFQWRKSRGS
VEKFHGAVVDHVGHINTRVGREVQELGDILNKLAPVAGSRVDAKVAIIFDWESRWAMDNA
QGPRNAGLFYEKTVTDHYRTFWEQGVAVDIINADVDLSGYQVVIAPMLYMVRDGFAERVD
AFVKQGGRFVTTYWSGVVNETDLCHQNGFPGPLRPIMGIWAEEIDGLYDHESNSISGLDG
NEQRLVGPYQVTHLCELIHLEGARALATYDSDFYAGRPAVTVNDYGKGQAYYIASRNDLA
FQRDFFTTLIKTQDLPRALPTDLPYGIVAHRRDDGESEFIFVQNYTATPQYITLPAAYEE
MTTGSTLSGALDLSGYGCRILRRALQ
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaattccccccactaagcagcaaggtgcccgttctgctgcacggtgctgactat
aatcctgaccaatggctagacaacccagaggtactggaaaaagacattgagatgatgaag
cagacccagtgcaacgtcatgtccgtgggcattttcagttggtctgggattgagccggaa
gaaggtcgctacgaatttggctggctggacagcatcctcaacacgctgtatgccaatggg
atcttcgtttttctggcaacacccagcggtgctcgtccagcctggctatcgcaaaaatac
ccggacgtgctgcgcgtgggtagcaaccgtgtacaggcgctgcacggcggtcgccacaac
cactgcctgagttcgccgaattatcgcgaaaaagtaaaacaaatgaacacccagttggca
aaacgctactcgcatcatcctgcggtgatcggctggcacatttccaacgaatacagcggc
gagtgccactgtgatacctgccgcagcactttccagagctggctgaaagcgcgctacggc
acgatagaggcgttgaataaagcgtggtggagcaccttctggagccacacctacaccgac
tggtcacagttagaaccgccgtcaccgattggtgaagtctctattcacggcctgaatctg
gactggaaacgctttaacacctcacaggttagtgatttctgtgccgcagaaattgcgccg
ctaaaagccgaaaacccgtctctgccaacgacgacgaacttcatggaatacttctatgat
tacgactactggcagttggcgaaggtgatcgactttatctcttgggacagctacccgctg
tggcataacgcggaagatgactgcacgctgggcgcctataccgcgatgtatcacgatctg
atgcgcacgctgaaaggtggaaagcccttctacctgatggaatcaacgccgagcctgacc
aactggcagccgatcagcaagctgaaaaagccgggtatgcacattctgtcttcgcttcag
gcggtcgcgcacggttcagactccgtgcagtatttccagtggcgtaagagccgcggttcc
gtcgagaaattccacggtgccgtcgtcgatcatgtcgggcacatcaatacccgcgtcggg
cgcgaagtacaggagttgggtgacatactcaataaactcgcccctgtcgcaggcagccga
gttgacgcaaaagtcgccattattttcgactgggaaagccgctgggcgatggataatgct
caaggaccgcgcaatgcagggctgttctatgaaaaaaccgtcaccgatcattatcggacg
ttctgggaacagggcgtggcggtggacatcatcaacgccgatgtcgacctcagcggttat
caggtcgtgattgcaccgatgctctacatggtgcgcgatggttttgccgaacgtgtcgat
gccttcgtcaaacaaggtggccgcttcgtcaccacctactggtcgggcgtcgttaacgaa
accgatctgtgccaccaaaacggtttccctggcccacttcgtcctatcatggggatctgg
gcggaagaaatcgacgggctgtacgatcatgaaagcaacagcatcagcggtctggatggt
aatgagcaacgtctggttggcccgtatcaggtcacccatctgtgcgagctgattcatctg
gaaggcgcgcgggcactggcgacctatgacagcgatttctatgcaggacgtccagccgtt
acggtcaatgattatggcaagggtcaggcctattacatcgcgtcgcgcaacgatctcgcc
ttccaacgtgatttcttcaccacgctgataaagacgcaggatctaccgcgtgcgctgccg
accgatctgccttacggcattgtcgctcatcgtcgcgatgacggggaaagtgagtttatc
ttcgtacagaattacacggcaacaccgcagtacattacgctgcctgccgcctacgaggaa
atgaccacgggcagcacgctttcaggggcgctcgacctgtcaggctacggctgtcggatt
ctccgccgcgcactacagtaa

DBGET integrated database retrieval system