KEGG   Pectobacterium atrosepticum SCRI1043: ECA3253Help
Entry
ECA3253           CDS       T00186                                 

Gene name
pemA
Definition
pectinesterase A (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECA3253 (pemA)
   00500 Starch and sucrose metabolism
    ECA3253 (pemA)
Enzymes [BR:eca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     ECA3253 (pemA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
3639338..3640444
Genome map
AA seq 368 aa AA seqDB search
MINASHLGKTLTLAMLISSPWALAQAADYNALVSANVTDAKAYKTITEAIASAPADSSPF
VIYVKNGVYHERLTVTRPNIHLQGESRDGTVITATTAAGMLKPDGSKWGTYGSNTVKVDA
PDFSARSLTISNDFDYPANQAKADEDPTKLKDSQAVALLVAENSDRAWFHDVSLTGYQDT
LYVKGGRSFFSKCRISGTVDFIFGNGTALFDDCDIVARNRTDVKDQPLGYLTAPSTDIKQ
KYGLVIINSRVIKEKDVPAKSYGLGRPWHPTTTFEDGRYADPNAIGQTVFLNTSMDDHIY
GWDKMSGKDKQGEKIWFHPQDSRFFEYKSSGTGTEKNDQRRQLSEAEAAEYTADKVLAGW
VPTAPKGK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgataaatgcttcacatctcggcaagacgctgaccttagccatgttaatttcctcaccc
tgggcgttagcgcaggcagccgactacaatgcgctggtttccgctaatgtaacggacgcc
aaagcctacaaaaccattactgaagctatcgccagtgccccggcagacagttctccgttt
gttatctatgtgaaaaatggcgtataccacgaacgtctcaccgttacgcgtcccaacatt
catctccagggcgaaagccgtgacggcaccgtgatcaccgcaaccaccgccgctgggatg
ctcaaaccagatggcagcaaatggggaacctatggcagcaacacggtgaaagtcgatgcc
cccgatttcagcgcccgttcactgaccattagcaacgatttcgattacccggccaatcag
gcaaaagctgatgaggatccaaccaaattaaaagactcgcaggccgttgcattattagtt
gccgaaaatagcgatcgtgcgtggttccatgatgtcagcctgacaggctatcaggatacg
ttatatgtgaaaggtggacgcagcttcttctcaaaatgccgtatcagcggcaccgttgat
ttcatctttggcaacggtactgcgctgtttgacgattgcgatatcgtcgcgcgtaaccgt
accgatgtgaaagatcagccgcttggctatctcaccgcccccagcaccgacattaaacaa
aaatatggtttggtcattatcaatagcagggtgattaaagagaaagacgttccggcgaaa
agctacggcctgggccgcccttggcacccaacgaccacctttgaagatggtcgctatgcc
gatcctaatgctatcggccagactgtcttcctgaacaccagcatggatgaccacatctat
ggctgggacaaaatgtcaggcaaagataaacaaggtgagaaaatctggttccatccgcag
gactcgcgctttttcgagtataaatccagtggcacaggcacagagaaaaacgatcagcgc
cgtcagttgagcgaggcggaagcggctgaatataccgcagataaggtattggcgggttgg
gttccgacagcgcctaaagggaagtaa

DBGET integrated database retrieval system