KEGG   Pectobacterium atrosepticum: ECA3320Help
Entry
ECA3320           CDS       T00186                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
eca  Pectobacterium atrosepticum
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:eca00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
3732230..3732727
Genome map
AA seq 165 aa AA seqDB search
MTRVYLALGSNLAQPLQQVRAALAALDAILQTRVIRCSSFYRSRPLGPQDQPDYLNAVVE
LETTLAAESLLDCTQAIELEQGRERKAHRWGPRTLDLDILLFGDAIIQTERLTVPHYDMK
NREFMLYPLVEIAPELTFPDGETLTQRLTDVDRNGLTLWDNSNPA
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcgtgtatctggcgctgggcagcaatcttgcccagcctttgcaacaggtacgc
gccgcactggctgcgctggatgcgattctacagactcgcgtcattcgctgttcctcgttt
tatcgtagtcgcccgctcggcccgcaggatcaaccggattatcttaatgccgtcgttgag
ttggaaactacattagccgccgagtcgttgctcgattgcacacaggctatcgagctggaa
caaggtcgcgaacgtaaggcgcaccgctggggtccgcgcacgttggatttggacattctg
ctgttcggtgatgccatcatccagacagaacgcctgacggtgccgcattacgacatgaaa
aatcgtgagttcatgctctatccgctcgtagaaatcgcccctgaactgacgttccccgac
ggcgaaacactcactcaacggttaaccgatgtcgaccgcaatggtctgacattgtgggac
aacagcaatcccgcctaa

DBGET integrated database retrieval system