KEGG   Pectobacterium atrosepticum SCRI1043: ECA3889Help
Entry
ECA3889           CDS       T00186                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
eca00260  Glycine, serine and threonine metabolism
eca00750  Vitamin B6 metabolism
eca01100  Metabolic pathways
eca01110  Biosynthesis of secondary metabolites
eca01120  Microbial metabolism in diverse environments
eca01230  Biosynthesis of amino acids
Module
eca_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECA3889 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ECA3889 (thrC)
Enzymes [BR:eca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ECA3889 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: CAG76787
GeneDB: ECA3889
UniProt: Q6D0B0
Position
complement(4352538..4353827)
Genome map
AA seq 429 aa AA seqDB search
MKLYNLKDHNEQVSFAQAIKQGLGSQQGLFFPLELPEFERTEIDALLDLDFVTRSSRILS
AYIGDEIATETVFERVKAAFAFPAPIAPVEDDVAALELFHGPTLAFKDFGGRFMAQMLTE
VSGNEKITILTATSGDTGAAVAHAFYGLENVRVVILYPQGKISPLQEKLFCTLGGNIHTI
AIDSDFDACQALVKKAFDDEELKKAIGLNSANSINISRLLAQICYYFEAVAQLPQEARNQ
LVVSVPSGNFGDLTAGLLAKSLGLPIKRFIAATNANDTVPRFLSQGNWEPHKTVATLSNA
MDVSQPNNWPRVEELFRRKNWQLKTLGFGAVSDDTTKETLLQLDALGYVSEPHAAIAYRL
LRDQLQAGEFGLFLGTAHPAKFKESVEEILGKELDLPEALAERADLDLLSHNFPDDFAPL
REFLMSLPE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtacaaccttaaagatcataacgagcaggtcagttttgctcaggctatcaag
caagggctcgggagccagcagggtctgttcttcccgctggagctgccagaatttgagcgt
actgaaattgatgctttgctggatctggattttgtgacccgcagcagccgtattctgtcc
gcttatatcggcgatgaaattgcgacagaaaccgtgtttgagcgtgtaaaagcggccttt
gcattcccagcacctatcgcgccagttgaggacgatgtcgcagcactggagttgttccac
ggcccgacgctggcctttaaagatttcggcggccgctttatggcgcaaatgctgacggaa
gtctctggcaacgaaaaaattaccattctgacggcaacctctggcgacaccggcgctgcc
gtggcgcatgccttttacggtctggaaaatgtccgcgtcgtgatcctgtatccgcagggc
aagatcagcccgctgcaggaaaagctgttctgtacactgggcggcaacattcacaccatc
gctatcgacagcgatttcgatgcctgtcaggcgttggtgaaaaaggcgtttgatgatgaa
gaactgaaaaaggcgattggcctgaactcagcgaactccattaacatcagccgtctgctg
gcgcaaatttgctactattttgaagccgttgcacaactgccacaggaagcccgtaaccaa
ctggtggtttctgtgccaagcggtaacttcggcgatctgaccgccggtctgctggcgaaa
tcgctgggtctgccgatcaagcgtttcattgcggcgactaacgccaatgacaccgtgccg
cgcttcctgagccagggtaattgggaaccgcataaaacggtggcaacgttatccaacgcg
atggatgtgagccagccaaacaactggccgcgcgtggaggaattgttccgccgtaagaac
tggcagttgaaaacgctgggctttggtgcggtgagcgatgacaccacgaaagaaaccctg
cttcagttggatgcgttaggctatgtctccgaaccgcatgctgcaattgcttaccgtctg
ctgcgcgatcagctgcaagctggtgagtttggcttgttcttgggtacggcgcacccggcg
aaattcaaggaaagcgtagaagagattctgggcaaagaactggatctgccggaagcgctg
gctgaacgtgccgatctggatctgctgtcgcacaacttcccggatgatttcgcaccgttg
cgtgagttcctgatgtccctgccagaataa

DBGET integrated database retrieval system