KEGG   Pectobacterium atrosepticum SCRI1043: ECA3889Help
Entry
ECA3889           CDS       T00186                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ECA3889 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECA3889 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ECA3889 (thrC)
Enzymes [BR:eca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ECA3889 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(4352538..4353827)
Genome map
AA seq 429 aa AA seqDB search
MKLYNLKDHNEQVSFAQAIKQGLGSQQGLFFPLELPEFERTEIDALLDLDFVTRSSRILS
AYIGDEIATETVFERVKAAFAFPAPIAPVEDDVAALELFHGPTLAFKDFGGRFMAQMLTE
VSGNEKITILTATSGDTGAAVAHAFYGLENVRVVILYPQGKISPLQEKLFCTLGGNIHTI
AIDSDFDACQALVKKAFDDEELKKAIGLNSANSINISRLLAQICYYFEAVAQLPQEARNQ
LVVSVPSGNFGDLTAGLLAKSLGLPIKRFIAATNANDTVPRFLSQGNWEPHKTVATLSNA
MDVSQPNNWPRVEELFRRKNWQLKTLGFGAVSDDTTKETLLQLDALGYVSEPHAAIAYRL
LRDQLQAGEFGLFLGTAHPAKFKESVEEILGKELDLPEALAERADLDLLSHNFPDDFAPL
REFLMSLPE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtacaaccttaaagatcataacgagcaggtcagttttgctcaggctatcaag
caagggctcgggagccagcagggtctgttcttcccgctggagctgccagaatttgagcgt
actgaaattgatgctttgctggatctggattttgtgacccgcagcagccgtattctgtcc
gcttatatcggcgatgaaattgcgacagaaaccgtgtttgagcgtgtaaaagcggccttt
gcattcccagcacctatcgcgccagttgaggacgatgtcgcagcactggagttgttccac
ggcccgacgctggcctttaaagatttcggcggccgctttatggcgcaaatgctgacggaa
gtctctggcaacgaaaaaattaccattctgacggcaacctctggcgacaccggcgctgcc
gtggcgcatgccttttacggtctggaaaatgtccgcgtcgtgatcctgtatccgcagggc
aagatcagcccgctgcaggaaaagctgttctgtacactgggcggcaacattcacaccatc
gctatcgacagcgatttcgatgcctgtcaggcgttggtgaaaaaggcgtttgatgatgaa
gaactgaaaaaggcgattggcctgaactcagcgaactccattaacatcagccgtctgctg
gcgcaaatttgctactattttgaagccgttgcacaactgccacaggaagcccgtaaccaa
ctggtggtttctgtgccaagcggtaacttcggcgatctgaccgccggtctgctggcgaaa
tcgctgggtctgccgatcaagcgtttcattgcggcgactaacgccaatgacaccgtgccg
cgcttcctgagccagggtaattgggaaccgcataaaacggtggcaacgttatccaacgcg
atggatgtgagccagccaaacaactggccgcgcgtggaggaattgttccgccgtaagaac
tggcagttgaaaacgctgggctttggtgcggtgagcgatgacaccacgaaagaaaccctg
cttcagttggatgcgttaggctatgtctccgaaccgcatgctgcaattgcttaccgtctg
ctgcgcgatcagctgcaagctggtgagtttggcttgttcttgggtacggcgcacccggcg
aaattcaaggaaagcgtagaagagattctgggcaaagaactggatctgccggaagcgctg
gctgaacgtgccgatctggatctgctgtcgcacaacttcccggatgatttcgcaccgttg
cgtgagttcctgatgtccctgccagaataa

DBGET integrated database retrieval system