KEGG   Pectobacterium atrosepticum SCRI1043: ECA3991Help
Entry
ECA3991           CDS       T00186                                 

Gene name
aceB
Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECA3991 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECA3991 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    ECA3991 (aceB)
Enzymes [BR:eca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ECA3991 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(4469014..4470612)
Genome map
AA seq 532 aa AA seqDB search
MMQQTINGELAFSQRFGEGEKHILTEEAIDYLTELVTHFTPARNQLLAERQVQQRNIDQG
KLPDFISETASIRDKAWTIRGIPDDLQDRRVEITGPVERKMVINALNANVKVFMADFEDS
LSPGWEKVIDGQINLRDAVRGTISYINETGKIYQLKPNPAVLVCRVRGLHLPEKHVSWQG
EAIPGSLFDFALYFFHNYQELLKKGSGPYFYLPKTQSWQEAAWWNDVFCYTEDRFDLPRG
TIKATVLIETLPAVFQMDEILYHLRDHIVGLNCGRWDYIFSYIKTLKNHSDRVLPDRQSV
TMEKPFLSAYSRLLIKTCHRRGAFAMGGMAAFIPSKDAERNNWVLDKVCKDKELEANNGH
DGTWVAHPGLADAVMEVFDRALGERKNQLDISREHDAFIRAEELLEPCPGERTEVGMRAN
IRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIRHGKTLSDGRVITKALFRQ
MLAEEMFVIQEELGDARFSGGRFDEAARLMEQITTQDELIDFLTLPGYALLD
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagcagacgataaacggagagttggcttttagtcagcgttttggcgaaggtgag
aagcacattcttacggaggaggcgattgattacctaacggaattagtcacgcatttcact
cccgcacgtaatcaattacttgctgaacgacaagtacagcagcgcaatatcgatcagggt
aagttgcctgattttatttcagaaacggcttccattcgagataaagcatggacgatacgc
ggcattcccgatgaccttcaggatcgccgtgttgaaattaccggcccagttgagcgcaag
atggtgatcaacgcattgaatgccaatgtgaaggttttcatggcggactttgaggattca
ctgtcaccgggatgggaaaaggtgattgatggacaaatcaatttacgtgatgccgtacgc
ggtacgatttcctatatcaacgaaacaggaaaaatctaccagctgaaacccaatcctgct
gtattggtttgccgcgtgcgcgggttgcatttacctgaaaaacacgtgtcctggcagggg
gaagccattcccggcagcttgtttgatttcgcgctgtattttttccacaactatcaggaa
ctgctgaagaaaggtagcggcccttatttctatttgccaaagactcagtcatggcaggaa
gcagcttggtggaacgatgtcttctgctatacagaagatcgctttgaccttccgcgtgga
acgatcaaagcaacggtgttgattgaaacgctgcctgctgttttccagatggacgaaatc
ctctatcacttacgcgatcatattgttgggttaaactgcgggcgctgggattatattttc
agttatatcaaaacattaaagaaccacagcgatcgcgttctgcccgatcgtcagtcggta
acgatggaaaaacctttccttagtgcttactcgcggctgttgatcaaaacctgccatcgc
cgtggcgcgtttgctatgggcgggatggcggcgttcattccaagtaaggatgctgagcgt
aataattgggtattggataaggtttgtaaagacaaggagttggaagcgaataatggtcac
gatggcacttgggtcgctcatccggggctggcagatgccgtgatggaggtgttcgatcgg
gcgttgggtgagcgcaaaaatcagcttgatatcagccgtgaacacgatgcgtttatccgt
gctgaggaattactggaaccctgtccgggagagcgcacggaagtcggtatgcgtgcgaat
atccgcgttgccgtgcagtacatcgaagcgtggatatctggtaatggctgcgtcccgatt
tatgggttgatggaagacgctgcgacggcagaaatttcccgaacctctatctggcagtgg
attcgtcacggcaagacgttgagcgatggtcgtgtgatcaccaaagcgctgttccgccag
atgttggccgaagagatgtttgtgattcaggaggaattaggtgatgcccgttttagcgga
gggcgcttcgatgaagccgctcggctgatggaacaaatcaccacgcaagatgaactgatc
gacttcctgacgttacccggctacgcattgcttgattaa

DBGET integrated database retrieval system