KEGG   Pectobacterium atrosepticum: ECA4026Help
Entry
ECA4026           CDS       T00186                                 

Gene name
rplV
Definition
50S ribosomal protein L22
Orthology
K02890  
large subunit ribosomal protein L22
Organism
eca  Pectobacterium atrosepticum
Pathway
Ribosome
Module
Ribosome, bacteria
Class
Genetic Information Processing; Translation; Ribosome [PATH:eca03010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(4497968..4498300)
Genome map
AA seq 110 aa AA seqDB search
METIAKHCHARSSAQKVRLVADLIRGKKVSQALEVLTYTNKKAAGLVKKVLESAIANAEH
NDGADIDDLKVAKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactatcgctaaacattgccacgctcgttcttctgctcaaaaggttcgcctagtg
gcagacctgattcgcggtaagaaagtgtcgcaagctctggaagttctgacctacaccaac
aagaaagctgctggtctggttaaaaaagtgcttgagtctgctattgctaacgcagaacac
aacgatggcgctgacattgatgatctgaaagtcgcgaaaattttcgttgacgaaggccca
agcatgaagcgcattatgccgcgtgctaaaggtcgtgcggatcgcatcctgaagcgtacc
agccacatcactgtggttgtgtccgatcgctga

DBGET integrated database retrieval system