KEGG   Pectobacterium atrosepticum SCRI1043: ECA4026Help
Entry
ECA4026           CDS       T00186                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal subunit protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
eca03010  Ribosome
Module
eca_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:eca00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    ECA4026 (rplV)
Ribosome [BR:eca03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    ECA4026 (rplV)
  Bacteria
    ECA4026 (rplV)
  Archaea
    ECA4026 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: CAG76923
GeneDB: ECA4026
UniProt: Q6CZX5
Position
complement(4497968..4498300)
Genome map
AA seq 110 aa AA seqDB search
METIAKHCHARSSAQKVRLVADLIRGKKVSQALEVLTYTNKKAAGLVKKVLESAIANAEH
NDGADIDDLKVAKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactatcgctaaacattgccacgctcgttcttctgctcaaaaggttcgcctagtg
gcagacctgattcgcggtaagaaagtgtcgcaagctctggaagttctgacctacaccaac
aagaaagctgctggtctggttaaaaaagtgcttgagtctgctattgctaacgcagaacac
aacgatggcgctgacattgatgatctgaaagtcgcgaaaattttcgttgacgaaggccca
agcatgaagcgcattatgccgcgtgctaaaggtcgtgcggatcgcatcctgaagcgtacc
agccacatcactgtggttgtgtccgatcgctga

DBGET integrated database retrieval system