KEGG   Pectobacterium atrosepticum: ECA4135Help
Entry
ECA4135           CDS       T00186                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
eca  Pectobacterium atrosepticum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:eca00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(4614891..4616966)
Genome map
AA seq 691 aa AA seqDB search
MDKLASQQTGIAESYTDAYGKEHIVAAAIINQIQEMMDVSDSGNAPLPPVRVFLQGRDAV
IKLAGHGEYFWTLMYENGGQIQGQITGGSTLALPGMLPLGYHYLTLTQADQRWSCRIIVA
PHRCYEPEALQQGKRWWGVTVQLYTLRSQNNWGVGDFGDLRQLVEQIARRGGAFVGLNPL
HSLYPALPEAASPYSPSSRHWLNIIYIDVNRVDDFQQSAEAQAWWHREETQSAITSLRAG
RWVDYEPVTQLKLAALRLAFRYFTTRSTLDPRISAFRQFVVSGGQSLQLQATFDALQAYL
KKQGENYADWHQWPASYHDVHSETVKSFRRENSDEITFYSWLQWMAHEQLADCYAHSKQL
GLPLGLYRDLAVGVAQGGAETWDERQLYCLDASIGAPPDPLGPQGQNWQLAPMNPTMMQL
RGYQPFIDVLRSNMAHCGALRIDHVMALLRLWWIPKAESAGSGAYVHYPVDDLLAVLALE
SQRHRCLIIGEDLGTVPPEIVSKLHDYGIYSYKVLFFEKDEENHFRAPEDYPRQAMATIT
THDLPTLRGYWQTVDLSLGRELGLYPAESLLQEQMQQREKAKQGLLNALHEFGLLPQRVG
RNSALTTMGAPLSRGVHRYVADSACALVGFQLEDWLDMATPVNVPGTNREYPNWRRKLTR
PLESIFADRCLERLVRDVDLRRGAPMKTQKA
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
gtggataaactggcaagccaacagacaggcatcgcggaaagctataccgatgcctatggc
aaagagcacattgttgcggccgcaatcatcaatcagattcaggaaatgatggacgtttct
gatagcggcaatgcgcccttgccgcctgttcgtgtctttttgcaaggccgggatgcggtc
atcaagcttgctggtcatggtgaatacttctggacgctgatgtatgaaaatggcgggcaa
attcaagggcagataacgggcggctcaacgctggctctgccgggcatgctgccgctgggc
taccactacctgacgctgacgcaggccgaccagcgctggagctgccggattattgtcgcg
ccgcaccgttgctatgaacccgaggccttacagcagggaaaacgctggtggggcgttacc
gtccagctttacaccttgcgctcgcagaacaactggggcgtgggggatttcggcgatctg
cgccaactggtggaacaaattgcccggcgtggcggtgccttcgtggggttgaacccactg
cattctctgtatcccgcgctgccagaggctgcaagtccttacagtccttcatcccgccac
tggctgaacattatttatatcgatgtgaatcgagttgatgatttccagcagagcgcggaa
gcgcaggcgtggtggcaccgtgaggagacgcaaagtgcgatcacatcgctgcgggcgggt
cgctgggttgattatgaaccggttacgcagcttaaactggctgccttgcggctggcgttt
cgctactttactacccgtagtacgctggatccgcgtattagcgcctttcgtcagtttgtc
gtcagcggcgggcagagtctgcaactccaggcgacgtttgatgcattgcaggcctacctg
aaaaagcagggcgagaattatgcggactggcaccagtggcccgccagctatcatgatgtt
cacagtgagaccgtgaagtcattccgccgtgaaaacagcgatgagattacgttctacagc
tggctacaatggatggcgcatgagcaattagccgactgttatgcgcacagtaagcagctt
ggcctgccgttaggcctgtatcgcgatttagccgttggcgttgcacagggcggcgcggaa
acgtgggacgaacgacagctatattgtcttgatgcttctatcggggcaccgccggatccg
cttgggccgcaggggcaaaattggcagcttgcaccgatgaaccccaccatgatgcagctt
cggggctatcaaccttttatcgacgtactgcgtagcaacatggcgcactgcggtgcattg
cgcatcgatcatgtgatggcgcttttgcgcctgtggtggatccccaaagcggagtcggcg
ggcagcggggcttatgtgcattatccggttgacgatctgctggcggtgctggcgctggaa
agccagcgtcatcgctgcctgattatcggtgaggatttaggcaccgtgccgccggaaatt
gtcagtaaactgcatgattatggtatctattcctacaaggtgctgttctttgaaaaggac
gaagagaatcacttccgtgcacccgaagattatccgcgtcaggcgatggcaaccatcacc
acccacgaccttccgacgctgcgcggctactggcaaacggtagatttatcgcttgggcgc
gagctagggctttaccctgcggagtcgttgttgcaggagcagatgcagcaacgtgagaaa
gcgaaacaggggctgctcaacgcgctacacgaatttggattactaccgcagcgtgttggc
cgcaactcggcgctgacgacgatgggcgcaccgctgagccgtggtgttcaccgttatgtc
gcggatagtgcatgtgcactggttgggtttcagctggaagattggctagatatggccaca
ccagtcaatgtaccgggcaccaaccgtgaataccccaactggcggcgcaagcttacgcgt
ccgctggaatcgatctttgctgaccgctgccttgaacgactggttcgggatgtggattta
cgccgcggcgcgccgatgaaaacgcaaaaagcctaa

DBGET integrated database retrieval system