KEGG   Pectobacterium atrosepticum SCRI1043: ECA4169Help
Entry
ECA4169           CDS       T00186                                 

Gene name
pldB
Definition
(GenBank) lysophospholipase L2
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
eca00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ECA4169 (pldB)
Enzymes [BR:eca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ECA4169 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9
Motif
Other DBs
NCBI-ProteinID: CAG77066
GeneDB: ECA4169
UniProt: Q6CZI2
Position
complement(4659695..4660732)
Genome map
AA seq 345 aa AA seqDB search
MIQRHNTLFTSERLTPESLTADLLTREAQFAAFATGELLNFWRQREEGEFSGVDDVPIRF
VRFTAPQHDKIVVVFSGRIESYVKYSEVAYDLFHRGYDVLIMDHRGQGRSGRVLQDGHRG
HVQRFSDYVDDAETLCQQHIEPTRYTRRFALAHSMGGAILAQLLVRQPAMFDAAALCAPM
FGIRLPLPHCVAEWIVDWAERHPAIRDYYAIGTGQWRPLPYRMNVLTHSRERYQRSIRFY
ADSPDLRVGGPTYHWVREAILAGKYLLTQASAVTTPLLLLQAEEERVVDNRSQNVFCQTL
TQSGDANSNGVLQVIHGARHEILFETDRLRAQAFALIFTHFARYH
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgattcaacgccacaatacgttgtttacgtcggaacggttaacacctgaatcgttaacg
gcagatctgttaacgcgagaagcgcagtttgccgcttttgctaccggagaattactgaat
ttctggcgtcagcgcgaagagggcgaattctctggtgtggatgatgtgccgatccggttt
gttcgctttaccgcgccgcaacacgacaagattgtcgtggttttttctggccgcatcgaa
agttacgtcaaatatagcgaagtggcgtatgacctctttcatcgcggctatgatgtgctc
atcatggatcaccgtgggcaagggcggtctgggcgggtgctgcaagatggccaccgcgga
cacgtgcaacgcttcagtgattatgtcgatgatgctgaaacactgtgccagcagcacatt
gaacctacgcgatatacccgtcggtttgcgctggcgcattcaatgggcggcgcgattctg
gcacagcttttggttcgtcaacctgcgatgtttgatgcggcggcgctgtgtgcgccgatg
tttggcattcgtttaccgcttcctcattgcgttgccgagtggatcgtcgattgggcggag
cgtcacccagcgatacgtgattattacgctataggcacgggacagtggcgtcctctgcct
tatcgaatgaatgtgctgacgcacagccgcgaacgctaccagcgtagtattcgattttac
gcggattcgcctgatttgcgcgtaggcggccctacttaccactgggtgcgtgaggcgata
ctggcggggaagtacctgctgacacaggccagcgccgtgacaacgccgcttctgctgcta
caagcggaagaggagcgcgtggtggataatcgcagtcagaatgtgttttgccagacactg
acgcagagcggtgatgccaattcgaacggcgttttgcaggttatccacggcgcgcggcat
gaaattctctttgagacggatcgtctccgcgctcaggcatttgcgctgatttttacgcac
tttgcgcgctatcattaa

DBGET integrated database retrieval system