KEGG   Pectobacterium atrosepticum SCRI1043: ECA4169Help
Entry
ECA4169           CDS       T00186                                 

Gene name
pldB
Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ECA4169 (pldB)
Enzymes [BR:eca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ECA4169 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(4659695..4660732)
Genome map
AA seq 345 aa AA seqDB search
MIQRHNTLFTSERLTPESLTADLLTREAQFAAFATGELLNFWRQREEGEFSGVDDVPIRF
VRFTAPQHDKIVVVFSGRIESYVKYSEVAYDLFHRGYDVLIMDHRGQGRSGRVLQDGHRG
HVQRFSDYVDDAETLCQQHIEPTRYTRRFALAHSMGGAILAQLLVRQPAMFDAAALCAPM
FGIRLPLPHCVAEWIVDWAERHPAIRDYYAIGTGQWRPLPYRMNVLTHSRERYQRSIRFY
ADSPDLRVGGPTYHWVREAILAGKYLLTQASAVTTPLLLLQAEEERVVDNRSQNVFCQTL
TQSGDANSNGVLQVIHGARHEILFETDRLRAQAFALIFTHFARYH
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgattcaacgccacaatacgttgtttacgtcggaacggttaacacctgaatcgttaacg
gcagatctgttaacgcgagaagcgcagtttgccgcttttgctaccggagaattactgaat
ttctggcgtcagcgcgaagagggcgaattctctggtgtggatgatgtgccgatccggttt
gttcgctttaccgcgccgcaacacgacaagattgtcgtggttttttctggccgcatcgaa
agttacgtcaaatatagcgaagtggcgtatgacctctttcatcgcggctatgatgtgctc
atcatggatcaccgtgggcaagggcggtctgggcgggtgctgcaagatggccaccgcgga
cacgtgcaacgcttcagtgattatgtcgatgatgctgaaacactgtgccagcagcacatt
gaacctacgcgatatacccgtcggtttgcgctggcgcattcaatgggcggcgcgattctg
gcacagcttttggttcgtcaacctgcgatgtttgatgcggcggcgctgtgtgcgccgatg
tttggcattcgtttaccgcttcctcattgcgttgccgagtggatcgtcgattgggcggag
cgtcacccagcgatacgtgattattacgctataggcacgggacagtggcgtcctctgcct
tatcgaatgaatgtgctgacgcacagccgcgaacgctaccagcgtagtattcgattttac
gcggattcgcctgatttgcgcgtaggcggccctacttaccactgggtgcgtgaggcgata
ctggcggggaagtacctgctgacacaggccagcgccgtgacaacgccgcttctgctgcta
caagcggaagaggagcgcgtggtggataatcgcagtcagaatgtgttttgccagacactg
acgcagagcggtgatgccaattcgaacggcgttttgcaggttatccacggcgcgcggcat
gaaattctctttgagacggatcgtctccgcgctcaggcatttgcgctgatttttacgcac
tttgcgcgctatcattaa

DBGET integrated database retrieval system