KEGG   Pectobacterium atrosepticum SCRI1043: ECA4267Help
Entry
ECA4267           CDS       T00186                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    ECA4267 (glpK)
Enzymes [BR:eca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     ECA4267 (glpK)
Exosome [BR:eca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ECA4267 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
4781238..4782749
Genome map
AA seq 503 aa AA seqDB search
MNPEKKYIVAIDQGTTSSRAVVLDHDANIVSVSQREFTQIYPKAGWVEHDPMEIWATQSS
TLVEVLAKADISADEVAGIGITNQRETTVVWEKESGKPIYNAIVWQCRRTAEICEKLKKD
GLEEYVRNTTGLVVDPYFSGTKVKWILDHVEGSRERAKRGELLFGTIDTWLIWKMTQGRV
HVTDYTNASRTMLFNIHTLEWDTRMLEALDIPREMLPEVRGSSEVYGQTNIGGKGGTRIP
IAGIAGDQQAALYGQLCVNPGQAKNTYGTGCFLLMNTGKEAVQSKHGLLTTIACGPRGEV
NYALEGSVFVGGASIQWLRDELKLIGDSMDSEYFATKVKDTNGVYVVPAFTGLGAPYWDP
YARGAIFGLTRGVNANHIIRATLESIAFQTRDVLDAMQADAGTRLKSLRVDGGAVANNFL
MQFQSDILGTRVERPEVRESTALGAAFLAGLATGFWNDLDEVKSKATIEREFRPSIETVE
RNVRYSGWQKAVARARNWEDHDA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaacccggaaaaaaaatacattgtcgcgatcgaccaaggcacaaccagctctcgcgcc
gtcgtactggatcacgatgcaaatatcgttagcgtttcacagcgtgaattcacccagatt
tatccaaaagcgggctgggtagagcacgacccgatggaaatttgggcaacacaaagctca
acgctggtcgaagtactagcgaaagccgatatcagtgcggatgaagtcgcgggtattggt
atcaccaaccagcgtgaaaccaccgtcgtatgggaaaaagagagcggcaagccgatttat
aacgccatcgtctggcagtgtcgtcgtaccgctgaaatttgcgagaaactgaagaaagac
ggtctggaagagtacgttcgcaacaccaccgggctggtggtcgatccctacttctctggc
accaaggtgaaatggattctggatcacgttgaaggctcccgtgagcgcgctaaacgcggc
gaattgctatttggtactatcgatacctggctgatttggaaaatgacgcaagggcgtgtt
cacgtaacggattacaccaacgcctcccgcaccatgctgtttaacattcatacgctagaa
tgggatacccgcatgctggaagcgctggatatcccgcgcgagatgctgccggaagtacgc
ggctcttcagaggtctacggccagaccaacatcggcggtaaaggcggcacgcgtattcct
atcgccggtatcgcgggtgaccagcaggcggcgctttacggccagctctgcgtcaaccct
gggcaggcgaaaaacacctacggcactggctgtttcctactaatgaataccggtaaagaa
gccgtgcagtccaaacacggtctgctgaccactatcgcctgtggcccgcgcggtgaagtg
aactacgcgctggaaggctccgtgttcgttggcggcgcatctatccaatggctgcgtgac
gagctgaagctgatcggcgactccatggactccgaatacttcgcgacaaaagtgaaggac
accaacggcgtctatgtcgtccccgctttcactggtttgggagccccctactgggacccg
tatgcccgtggcgcgatcttcggtctgacccgtggcgtgaacgctaaccacatcatccgt
gcgacgctggaatccatcgccttccagacccgtgacgtgctggatgccatgcaggcagac
gcggggacgcgtctgaaatcactgcgtgtcgacggtggcgcagtcgccaacaacttcctg
atgcagttccagtccgatatcctcggcacgcgcgtggaacgtccggaagtacgtgaatcc
accgcattgggtgccgcgttcttggctggccttgccactggcttctggaacgatctggat
gaagtgaagagcaaagcgactattgagcgtgaattccgccccagcatagaaacggtggag
cggaacgttcgttacagcggctggcagaaagccgttgctcgtgctcgtaactgggaagat
cacgacgcctaa

DBGET integrated database retrieval system