KEGG   Pectobacterium atrosepticum: ECA4267Help
Entry
ECA4267           CDS       T00186                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
eca  Pectobacterium atrosepticum
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:eca00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
4781238..4782749
Genome map
AA seq 503 aa AA seqDB search
MNPEKKYIVAIDQGTTSSRAVVLDHDANIVSVSQREFTQIYPKAGWVEHDPMEIWATQSS
TLVEVLAKADISADEVAGIGITNQRETTVVWEKESGKPIYNAIVWQCRRTAEICEKLKKD
GLEEYVRNTTGLVVDPYFSGTKVKWILDHVEGSRERAKRGELLFGTIDTWLIWKMTQGRV
HVTDYTNASRTMLFNIHTLEWDTRMLEALDIPREMLPEVRGSSEVYGQTNIGGKGGTRIP
IAGIAGDQQAALYGQLCVNPGQAKNTYGTGCFLLMNTGKEAVQSKHGLLTTIACGPRGEV
NYALEGSVFVGGASIQWLRDELKLIGDSMDSEYFATKVKDTNGVYVVPAFTGLGAPYWDP
YARGAIFGLTRGVNANHIIRATLESIAFQTRDVLDAMQADAGTRLKSLRVDGGAVANNFL
MQFQSDILGTRVERPEVRESTALGAAFLAGLATGFWNDLDEVKSKATIEREFRPSIETVE
RNVRYSGWQKAVARARNWEDHDA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaacccggaaaaaaaatacattgtcgcgatcgaccaaggcacaaccagctctcgcgcc
gtcgtactggatcacgatgcaaatatcgttagcgtttcacagcgtgaattcacccagatt
tatccaaaagcgggctgggtagagcacgacccgatggaaatttgggcaacacaaagctca
acgctggtcgaagtactagcgaaagccgatatcagtgcggatgaagtcgcgggtattggt
atcaccaaccagcgtgaaaccaccgtcgtatgggaaaaagagagcggcaagccgatttat
aacgccatcgtctggcagtgtcgtcgtaccgctgaaatttgcgagaaactgaagaaagac
ggtctggaagagtacgttcgcaacaccaccgggctggtggtcgatccctacttctctggc
accaaggtgaaatggattctggatcacgttgaaggctcccgtgagcgcgctaaacgcggc
gaattgctatttggtactatcgatacctggctgatttggaaaatgacgcaagggcgtgtt
cacgtaacggattacaccaacgcctcccgcaccatgctgtttaacattcatacgctagaa
tgggatacccgcatgctggaagcgctggatatcccgcgcgagatgctgccggaagtacgc
ggctcttcagaggtctacggccagaccaacatcggcggtaaaggcggcacgcgtattcct
atcgccggtatcgcgggtgaccagcaggcggcgctttacggccagctctgcgtcaaccct
gggcaggcgaaaaacacctacggcactggctgtttcctactaatgaataccggtaaagaa
gccgtgcagtccaaacacggtctgctgaccactatcgcctgtggcccgcgcggtgaagtg
aactacgcgctggaaggctccgtgttcgttggcggcgcatctatccaatggctgcgtgac
gagctgaagctgatcggcgactccatggactccgaatacttcgcgacaaaagtgaaggac
accaacggcgtctatgtcgtccccgctttcactggtttgggagccccctactgggacccg
tatgcccgtggcgcgatcttcggtctgacccgtggcgtgaacgctaaccacatcatccgt
gcgacgctggaatccatcgccttccagacccgtgacgtgctggatgccatgcaggcagac
gcggggacgcgtctgaaatcactgcgtgtcgacggtggcgcagtcgccaacaacttcctg
atgcagttccagtccgatatcctcggcacgcgcgtggaacgtccggaagtacgtgaatcc
accgcattgggtgccgcgttcttggctggccttgccactggcttctggaacgatctggat
gaagtgaagagcaaagcgactattgagcgtgaattccgccccagcatagaaacggtggag
cggaacgttcgttacagcggctggcagaaagccgttgctcgtgctcgtaactgggaagat
cacgacgcctaa

DBGET integrated database retrieval system