KEGG   Pectobacterium atrosepticum: ECA4307Help
Entry
ECA4307           CDS       T00186                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
eca  Pectobacterium atrosepticum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECA4307 (pfkA)
   01230 Biosynthesis of amino acids
    ECA4307 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECA4307 (pfkA)
   00030 Pentose phosphate pathway
    ECA4307 (pfkA)
   00051 Fructose and mannose metabolism
    ECA4307 (pfkA)
   00052 Galactose metabolism
    ECA4307 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    ECA4307 (pfkA)
Enzymes [BR:eca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ECA4307 (pfkA)
Protein phosphatases and associated proteins [BR:eca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ECA4307 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(4824827..4825789)
Genome map
AA seq 320 aa AA seqDB search
MIRRIGVLTSGGDAPGMNAAIRGVVRAALSEGLEIYGIYDGYQGLYEDRMEQLDRYSVSD
VINRGGTFLGSARFPQFRDEAVRQVCVENMQRRGLDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDVAGTDYTIGYFTALETVLEAIDRLRDTSSSHQRISIVEVMGRHCGDLTLA
AAIAGGCEFIVLPEVPFSPEDLVSEIKAGIEKGKKHAIVAITELVCDVDELAKYIEKETG
RETRSTVLGHIQRGGSPVAYDRILASRMGAYSIELLQQGYGGRCVGIQNEKMVHHDIVDA
IENMKRPFKGDWLETAKKLF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattagaagaatcggagtgttgacgagcggtggcgatgcaccaggtatgaatgcggca
attcgaggtgtggttcgtgctgcactgtcggaagggctggaaatctacggcatttatgat
ggctatcagggcttgtacgaagatcgcatggagcagttggatcgctacagcgtatcggat
gtaattaaccgcggcggtacgttccttggttccgcacgcttcccacagttccgtgatgaa
gcggtgcgtcaggtctgcgtagaaaacatgcagagacgcggtctggatgcgttggtggtt
atcggcggtgacggttcctacatgggtgctaaacgtctgacggaaatgggttttccctgt
atcggcttgccgggcacgatcgataacgacgtggcgggtacagactacaccatcggctac
tttaccgcgctggaaaccgtgctggaagcgattgaccgcctgcgcgatacctcctcttcc
caccagcgtatttcgattgttgaagtcatgggacgccactgtggtgacctgacgctggcg
gcggcaattgctggcggctgtgaatttatcgtcctgccggaagtgccgtttagcccggaa
gatctggttagcgaaattaaagcgggtatcgaaaaaggtaaaaagcacgcgattgtggca
atcaccgagctggtgtgcgacgtcgatgagctggcgaaatacattgagaaagagacggga
cgtgaaacccgttcgaccgtactcggtcacattcagcgcggcggttcgccggtcgcgtac
gatcgtattctggcctcccgtatgggtgcctattcgattgagctgctacagcaaggctac
ggtggtcgctgtgtcggtatccagaatgaaaaaatggtgcaccacgacatcgtggacgcc
atcgagaatatgaagcgtcctttcaaaggcgactggttggagacggcgaagaaattgttc
tga

DBGET integrated database retrieval system