KEGG   Pectobacterium atrosepticum: ECA4373Help
Entry
ECA4373           CDS       T00186                                 

Gene name
bcsZ
Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
eca  Pectobacterium atrosepticum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:eca00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
4898429..4899544
Genome map
AA seq 371 aa AA seqDB search
MPRVLRYLILTLLWLWASLATAAVCDWPAWEQYKQHYISEQGRVIDTSTPNKITTSEGQS
YAMFFALVANDRAMFDRLLKWTEDNLSAGDLRANLPAWLWGESKDKQWAVLDPNSASDAD
LWIAYNLLEAGRLWKEARYQTLGTTLLARIAKEEVVNIPGLGVMLLPGKVGFAEKESWRV
NPSYLPPQLLARFAPLGETWKSMQRTTQRLLLETAPKGFSPDWVIWQKGKGWQPDTTKPN
IGSYDAIRVYLWAGMMADSSRGKADLLKQFQPMIQQTLQQGLPPEKADTATGVVTGQGPV
GFSASLLPILSRQPDALAAQRQRLAANPPGDDAYFSASLTLFGQGWDEKRYRFTSQGQLL
PSRGSQCTTTP
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgccacgcgtgctgcgctacctgatcctcacgctgctgtggctatgggcttccctagcc
accgcggccgtctgcgactggcccgcctgggaacagtacaaacagcattacatcagtgag
caagggcgggtgattgatacctccacgcccaataaaatcaccacgtccgaagggcaaagc
tacgccatgttctttgcactggtcgccaacgatcgggcgatgtttgacaggctgctgaaa
tggacggaagacaacctgtccgctggcgatttacgcgctaacttgccggcctggctgtgg
ggagaaagcaaagataagcagtgggcggtgctggatccgaactccgcatccgacgccgat
ctgtggattgcctataacctgcttgaagccggccgactgtggaaagaagcgcgttatcag
acgctaggcaccacgctgctcgcgcgtattgccaaggaagaagtcgttaacattccaggg
ttaggcgtgatgctattgcccggcaaagtgggcttcgcagagaaagaaagctggcgcgta
aaccctagctaccttccgccgcagctgttggcccgttttgctccgctgggtgagacgtgg
aaatccatgcaacgcaccacgcagcgcctgctattggaaactgcaccgaaaggattttcg
cccgattgggtcatctggcaaaaaggcaaaggctggcaacctgataccaccaaacccaat
atcggtagctatgacgccattcgcgtctacctgtgggcagggatgatggctgacagcagc
agagggaaagccgacttgctcaaacagtttcaaccgatgattcaacagacgctccaacag
ggtttaccgcccgaaaaagcggacaccgcgacaggcgtggtcaccggacaggggcccgtc
gggttttccgcttcactacttccgatactatcccgccagccggatgcgctagccgctcag
cgacaacggctcgccgcgaatccaccgggtgacgatgcctatttctctgcttctctgacg
ctctttggtcagggatgggatgaaaagcgctaccgcttcacgtcacaaggccaactttta
ccatcgcggggcagccaatgcacaacaacaccttaa

DBGET integrated database retrieval system