KEGG   Enterococcus casseliflavus: ECBG_01601Help
Entry
ECBG_01601        CDS       T02623                                 

Definition
aldehyde-alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ecas  Enterococcus casseliflavus
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ecas00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ECBG_01601
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECBG_01601
   00620 Pyruvate metabolism
    ECBG_01601
   00650 Butanoate metabolism
    ECBG_01601
  Lipid metabolism
   00071 Fatty acid degradation
    ECBG_01601
  Amino acid metabolism
   00350 Tyrosine metabolism
    ECBG_01601
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ECBG_01601
   00626 Naphthalene degradation
    ECBG_01601
Enzymes [BR:ecas01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ECBG_01601
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     ECBG_01601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
470289..472880
Genome map
AA seq 863 aa AA seqDB search
MAKTLEKEVTIDVQAMIDDLATKANVALKEMESFDQEKVDHIVHEMAMAALDKHMPLAKM
AVEETGRGIYEDKAIKNMYASEYIWNSIKHDKTVGVINEDKQKGLIEIAEPVGVVCGVTP
TTNPTSTTIFKAMIALKTRNPIVFAFHPSAQKCSAEAARIVRDAAIAAGAPENCVQWIEH
PSIEATGLLMNHPGIAIVLATGGAGMVKAAYSTGKPALGVGPGNVPAYIEKTAKVKRAVN
DLIVSKTFDNGMICASEQAVIVDKEVYASVKAEFEAHQVYVVKAKELQKLEDAVMNEGKY
AVNPAIVGHSAMEIAKLAGINVPEGTKLLIAELDGVGADYPLSREKLSPVLAMIKANNTE
DAFEKCEAMLDLGGLGHTAVIHTENEDLQLAFGLRMKACRILVNTPSAEGGIGNIYNEMI
PSLTLGCGSYGKNSVSRNVSAVNLINVKTVAKRRNNMQWFKLPPKIFFEKNSLMYLEKME
NVERVMIVCDPGMVQFGYCDTVREVLARRKNDVKIEVFSDVEPNPSTNTVYAGTKMMVDF
KPDTVIALGGGSAMDAAKGMWMFYEHPDTSFFGAKQKFLDIRKRTYKIDKPEKTQFVCIP
TTSGTGSEVTPFAVITDSETHVKYPLADYALTPDVAIVDPQFVMSVPASVTADTGMDVLT
HAIESYVSVMASDYTRGLSLQAIKLVFDYLEKSVKTPDMESREKMHNASTMAGMAFANAF
LGICHSVAHKIGGEYGIPHGRTNAILLPHIIRYNAKDPQKHAMFPKYDFFRADTDYADIA
KFLGLKGKTTAELVEALATAVYELGQSVGIDMSLKAQGVTQQTLDTTVDRMAELAYEDQC
TTANPKEPLISELKQIIVDAYNG
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atggctaagacattggaaaaagaagtgacgatcgacgtacaagcaatgattgacgattta
gcaacgaaggcaaatgtggcgttaaaagaaatggaaagctttgatcaagaaaaagtggac
cacattgttcatgaaatggcaatggcagcattagacaaacatatgcctttagctaaaatg
gcagtagaagaaactggccgtggtatctatgaagataaagcgatcaaaaacatgtacgct
tcagaatatatttggaacagtatcaaacatgacaaaacagtcggcgtgatcaatgaagac
aaacaaaaaggcttgatcgaaatcgctgaaccagttggtgtcgtttgtggggtaacacca
acaactaacccaacatctacaacgatctttaaagcaatgatcgctttgaaaacacgtaac
ccgatcgtttttgctttccacccatctgcacaaaaatgttcagcagaagctgcacgtatc
gttcgtgatgcagccatcgctgctggggcacctgaaaactgtgtgcaatggatcgaacat
ccatcaatcgaagcgactggcttattgatgaaccacccaggaattgcgatcgtattagca
actggtggcgctggcatggtcaaagcagcatactcaactggtaaacctgcattaggtgtt
ggaccagggaacgtacctgcatatatcgaaaaaacagcgaaagtgaaacgagcagtcaat
gacttgatcgtatcaaaaacttttgataacggaatgatctgtgcctctgaacaagcagtg
atcgttgataaagaagtctatgcctctgtgaaagcagaatttgaagcacatcaagtatat
gttgtaaaagcaaaagaattacaaaaacttgaagatgccgtgatgaacgaaggaaaatat
gccgtaaatccagcaatcgttggacattcagcaatggaaatcgcgaaattagcaggcatc
aacgtaccagaaggaacaaaattattgatcgctgaacttgacggtgtcggtgctgattac
ccactatcaagagaaaaactttctccagttttagcaatgatcaaagcaaacaacacagaa
gacgcgttcgaaaaatgtgaagcaatgcttgatttaggcggactaggccatacagcggtg
atccacactgaaaacgaagacttgcaattagcattcggcctacgcatgaaagcttgccgt
atcttagttaacacaccatctgcagaaggtggtatcggaaatatctacaacgaaatgatt
ccatcattgacacttggttgtggttcatacgggaaaaactctgtatcacgaaatgtttct
gctgtgaacttgatcaacgtgaaaactgtagcgaaacggagaaataatatgcaatggttt
aaattgccaccaaaaatcttctttgaaaagaactctctaatgtacttggagaaaatggaa
aacgttgaacgtgtcatgatcgtttgtgaccctggtatggttcaattcggctattgcgat
acggttcgtgaagtacttgctcgtcgtaaaaatgacgtgaaaatcgaagtcttctctgac
gtagaaccaaacccatcaacaaacaccgtttacgctggaacaaaaatgatggttgatttc
aaaccagatacagtgatcgcccttggtggtggatcagcaatggatgctgccaaaggcatg
tggatgttctatgagcacccagatacttcattcttcggcgcgaaacaaaaattcttagat
atccgtaaacggacatacaagatcgacaaaccagaaaaaacgcaattcgtttgtatccca
acaacgtctggtactggttctgaagtaaccccatttgcggttatcactgacagtgaaaca
cacgtgaagtacccattagctgattacgcattgacaccagatgttgcaatcgttgaccct
caattcgtaatgtcagtacctgcttctgttacagcagacactggaatggacgttttgact
catgcgatcgaatcttatgtgtcagtaatggcatctgattacactcgtggattgagctta
caagcaatcaagttagtctttgactacttagaaaaatcagtgaaaacacctgatatggaa
tctcgcgaaaaaatgcataatgcctcaacaatggcaggtatggccttcgccaatgcattc
ctaggtatttgtcactcagtagcccacaaaatcggtggtgaatatggtattcctcacgga
cgtacaaatgcgattcttttaccgcacatcatccgttacaatgccaaagacccacaaaaa
catgcaatgttccctaaatatgacttcttccgtgctgatacagattacgcagacattgcg
aaattcttaggccttaaaggcaaaacaacggctgaattggttgaagcattggcaacagct
gtttacgaattaggacaatctgtgggtatcgacatgagcttgaaagcgcaaggcgtcact
caacaaacactagatacaacagttgatcgcatggctgaattggcttacgaagaccaatgt
acaacagcaaatccaaaagaaccactaatctctgaattgaaacaaatcatcgttgatgcc
tataacggctaa

DBGET integrated database retrieval system