KEGG   Enterococcus casseliflavus: ECBG_01649Help
Entry
ECBG_01649        CDS       T02623                                 

Definition
hypothetical protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ecas  Enterococcus casseliflavus
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ecas00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ECBG_01649
  Lipid metabolism
   00561 Glycerolipid metabolism
    ECBG_01649
   00600 Sphingolipid metabolism
    ECBG_01649
Enzymes [BR:ecas01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     ECBG_01649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
525599..527830
Genome map
AA seq 743 aa AA seqDB search
MIYINNNKEFHLTNGMISYICRVEEKTGVLEQLYFGSAIPHQPTFDYLIEREIRPSNNFK
KEDHTSSLEHIKQEMPMYGTTDFRYPAVEVQYPDGDAISHFNYSNYRISNKKRKIPNLPT
SFYDEAEAETLTIVLKDRYSSLTIEMDYTIFKDFPIISRQNHIVHHDDCRYQLMRFMSMS
LDLPIDDCDWLHLDGAWARETQVKRDKLHSGLQQISSTRGASSHIHNPFFAICEKSATEF
QGDVYAFSLIYSGNFVGQIEVDTYRISRVQMGINPYQFSWQLEKGDVFSSPEVIMNYAQN
GFNEMSRNFHAFFKKHLIRQTWASKERPVLINNWEATYFNFDESKIQALAQEAADLGIEL
FVLDDGWFGHRDNDASSLGNWQVDKRKLPHGIRSLSQKIHEKGLKFGLWFEPEMVSMDTP
LYQAHPDWIVGHPQKNISHGRNQYVLDFSQNCVIDCIFEQMDAVLKACEIDYVKWDMNRY
ISEAYSVSLGKQRQGEFFHRYILGVYALYEKLLAKYPDLLIESCAGGGGRFDPALLYYAP
QTWTSDDTDAIERLKIQYGASMVYPLSAIGSHVSEVPNHQVARMTSLKMRSDVALFGTFG
YELDVTKLSQREKSQVKNQIILFKKHRMLLHTGTFFRLQSPFNGNVCAWMVVSENQTEAL
IGYYQILAEPNPPYQRLRLKGLNADFDYTIWEKEQVRTGKDLMAVGLIFGENYIDRASDF
WQRQMAGDFSSKLIYLTRNKMQS
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgatctatattaataataataaggagtttcacttaacgaatggaatgattagttatatc
tgtagggttgaggaaaaaacaggtgtcttggagcagttatactttggatcagccattcct
catcaaccaacgtttgattacttgattgaacgtgagattcgtccttctaataacttcaag
aaagaggatcatacctcttcgctggaacatattaagcaagaaatgccaatgtatgggaca
acagattttcgctatcctgccgttgaagttcaatacccagatggagatgctatcagtcat
tttaactattcgaattatcggatatcaaataaaaagagaaaaatccctaatttgccaact
agtttctatgacgaagcagaagctgaaacgctgacgattgtattaaaagatcgttattct
tcgttgacaattgaaatggattacactattttcaaagatttccctatcatttctagacag
aatcatatcgtgcatcatgatgattgccgttaccagttgatgcggtttatgagtatgagt
cttgatttgccaatagatgactgcgattggctgcatttagatggtgcttgggccagggaa
acgcaagtgaagagggacaaactgcatagtggattgcagcaaatttccagtacccgcggt
gccagcagtcatatccacaatcccttttttgcaatatgcgaaaagtctgcaactgaattt
caaggagacgtgtacgcatttagtcttatttatagcggaaattttgttggacaaatcgaa
gtggatacatatcgtatctctcgtgttcaaatggggatcaatccctatcaattttcttgg
caattagaaaaaggtgacgttttctccagcccagaagtcataatgaattatgcacaaaat
ggctttaatgaaatgagtagaaacttccatgctttttttaaaaagcatttgattcgccaa
acgtgggcatcgaaggaacgtcctgtgttgataaataattgggaagccacttactttaat
tttgatgaatcaaagattcaggcattagctcaagaagcagccgatttagggatagaattg
tttgttttagatgacggctggtttggtcatcgagacaatgatgcttcttcattaggaaac
tggcaagtcgacaaaaggaaattaccgcatggcattcgcagtttatcacaaaaaatccat
gaaaaaggtttgaaattcgggctatggtttgaaccagaaatggtttctatggatacacct
ctttaccaagctcaccctgattggatagtggggcacccgcaaaagaacatttcacatggg
cgaaatcaatacgtgttggattttagtcagaattgcgtcattgactgtatttttgaacag
atggatgcagtgttaaaggcatgtgagattgattatgtgaagtgggacatgaatcgctat
atctcagaagcgtattccgtctcgttaggaaaacagcggcaaggcgagtttttccatcgt
tatattttaggcgtctatgctttgtacgaaaaactgttagcaaaatatcctgatttgtta
atagaatcctgtgctggcggcggcggtcgatttgaccctgccttactgtactatgctcct
caaacgtggacgagtgatgatacagatgcgatagagcgcctcaagattcaatacggtgca
tcaatggtttatccgctctctgcgataggaagtcacgtatctgaggtgcctaatcatcaa
gtggccaggatgacgtcattaaaaatgagaagtgatgttgccttgtttggcacatttggg
tatgaattagatgtgactaagctttctcaaagagaaaaaagtcaggtcaaaaaccagatc
atactttttaaaaaacatcggatgctgcttcatacgggcacttttttccgtctgcaaagt
ccttttaatgggaatgtatgcgcatggatggtcgtttctgaaaatcaaacagaagctttg
attggttattatcaaatcttagcagagcctaatccgccttatcagcgcttgcgattaaaa
ggattgaacgcagattttgattatacgatatgggaaaaagaacaggttcgaacggggaaa
gatttgatggctgtcggcttgatttttggcgagaattatattgatcgagcatcagatttt
tggcaacgacaaatggcaggggatttttcttcaaagctcatttatttaacacgaaacaaa
atgcagagttaa

DBGET integrated database retrieval system