KEGG   Enterococcus casseliflavus: ECBG_01649Help
Entry
ECBG_01649        CDS       T02623                                 

Definition
hypothetical protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ecas  Enterococcus casseliflavus
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ecas00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ecas00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ecas00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
525599..527830
Genome map
AA seq 743 aa AA seqDB search
MIYINNNKEFHLTNGMISYICRVEEKTGVLEQLYFGSAIPHQPTFDYLIEREIRPSNNFK
KEDHTSSLEHIKQEMPMYGTTDFRYPAVEVQYPDGDAISHFNYSNYRISNKKRKIPNLPT
SFYDEAEAETLTIVLKDRYSSLTIEMDYTIFKDFPIISRQNHIVHHDDCRYQLMRFMSMS
LDLPIDDCDWLHLDGAWARETQVKRDKLHSGLQQISSTRGASSHIHNPFFAICEKSATEF
QGDVYAFSLIYSGNFVGQIEVDTYRISRVQMGINPYQFSWQLEKGDVFSSPEVIMNYAQN
GFNEMSRNFHAFFKKHLIRQTWASKERPVLINNWEATYFNFDESKIQALAQEAADLGIEL
FVLDDGWFGHRDNDASSLGNWQVDKRKLPHGIRSLSQKIHEKGLKFGLWFEPEMVSMDTP
LYQAHPDWIVGHPQKNISHGRNQYVLDFSQNCVIDCIFEQMDAVLKACEIDYVKWDMNRY
ISEAYSVSLGKQRQGEFFHRYILGVYALYEKLLAKYPDLLIESCAGGGGRFDPALLYYAP
QTWTSDDTDAIERLKIQYGASMVYPLSAIGSHVSEVPNHQVARMTSLKMRSDVALFGTFG
YELDVTKLSQREKSQVKNQIILFKKHRMLLHTGTFFRLQSPFNGNVCAWMVVSENQTEAL
IGYYQILAEPNPPYQRLRLKGLNADFDYTIWEKEQVRTGKDLMAVGLIFGENYIDRASDF
WQRQMAGDFSSKLIYLTRNKMQS
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgatctatattaataataataaggagtttcacttaacgaatggaatgattagttatatc
tgtagggttgaggaaaaaacaggtgtcttggagcagttatactttggatcagccattcct
catcaaccaacgtttgattacttgattgaacgtgagattcgtccttctaataacttcaag
aaagaggatcatacctcttcgctggaacatattaagcaagaaatgccaatgtatgggaca
acagattttcgctatcctgccgttgaagttcaatacccagatggagatgctatcagtcat
tttaactattcgaattatcggatatcaaataaaaagagaaaaatccctaatttgccaact
agtttctatgacgaagcagaagctgaaacgctgacgattgtattaaaagatcgttattct
tcgttgacaattgaaatggattacactattttcaaagatttccctatcatttctagacag
aatcatatcgtgcatcatgatgattgccgttaccagttgatgcggtttatgagtatgagt
cttgatttgccaatagatgactgcgattggctgcatttagatggtgcttgggccagggaa
acgcaagtgaagagggacaaactgcatagtggattgcagcaaatttccagtacccgcggt
gccagcagtcatatccacaatcccttttttgcaatatgcgaaaagtctgcaactgaattt
caaggagacgtgtacgcatttagtcttatttatagcggaaattttgttggacaaatcgaa
gtggatacatatcgtatctctcgtgttcaaatggggatcaatccctatcaattttcttgg
caattagaaaaaggtgacgttttctccagcccagaagtcataatgaattatgcacaaaat
ggctttaatgaaatgagtagaaacttccatgctttttttaaaaagcatttgattcgccaa
acgtgggcatcgaaggaacgtcctgtgttgataaataattgggaagccacttactttaat
tttgatgaatcaaagattcaggcattagctcaagaagcagccgatttagggatagaattg
tttgttttagatgacggctggtttggtcatcgagacaatgatgcttcttcattaggaaac
tggcaagtcgacaaaaggaaattaccgcatggcattcgcagtttatcacaaaaaatccat
gaaaaaggtttgaaattcgggctatggtttgaaccagaaatggtttctatggatacacct
ctttaccaagctcaccctgattggatagtggggcacccgcaaaagaacatttcacatggg
cgaaatcaatacgtgttggattttagtcagaattgcgtcattgactgtatttttgaacag
atggatgcagtgttaaaggcatgtgagattgattatgtgaagtgggacatgaatcgctat
atctcagaagcgtattccgtctcgttaggaaaacagcggcaaggcgagtttttccatcgt
tatattttaggcgtctatgctttgtacgaaaaactgttagcaaaatatcctgatttgtta
atagaatcctgtgctggcggcggcggtcgatttgaccctgccttactgtactatgctcct
caaacgtggacgagtgatgatacagatgcgatagagcgcctcaagattcaatacggtgca
tcaatggtttatccgctctctgcgataggaagtcacgtatctgaggtgcctaatcatcaa
gtggccaggatgacgtcattaaaaatgagaagtgatgttgccttgtttggcacatttggg
tatgaattagatgtgactaagctttctcaaagagaaaaaagtcaggtcaaaaaccagatc
atactttttaaaaaacatcggatgctgcttcatacgggcacttttttccgtctgcaaagt
ccttttaatgggaatgtatgcgcatggatggtcgtttctgaaaatcaaacagaagctttg
attggttattatcaaatcttagcagagcctaatccgccttatcagcgcttgcgattaaaa
ggattgaacgcagattttgattatacgatatgggaaaaagaacaggttcgaacggggaaa
gatttgatggctgtcggcttgatttttggcgagaattatattgatcgagcatcagatttt
tggcaacgacaaatggcaggggatttttcttcaaagctcatttatttaacacgaaacaaa
atgcagagttaa

DBGET integrated database retrieval system