KEGG   Enterococcus casseliflavus: ECBG_01973Help
Entry
ECBG_01973        CDS       T02623                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ecas  Enterococcus casseliflavus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ecas00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ECBG_01973
Enzymes [BR:ecas01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     ECBG_01973
Exosome [BR:ecas04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ECBG_01973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2193816..2195735)
Genome map
AA seq 639 aa AA seqDB search
MVTKQQVLTAEKDFLSGENFYVQHFLGAHQVDDGYVFRVWAPNAQQVWLVGDFNQWTDTL
PMNKRTESGVWEIETNQVKEGQLYKYKVKQANGREVLKIDPFAVHFEARPGTAAVLHSIP
QKKWRDGLWQGRKKRQKTFNRPLNIYEVHASSWKHHEDGTPYRFSELKDELIPYVKKMGY
THIEFMPLMEHPLGTSWGYQLTGYFALSSYYGTPEEFQDFVEACHLENIGVFVDWVPGHF
CVNDDSLAYYDGTPTFEYMDENRAKNVRWGAINFDLGKPQVQSFLISSALFWIEFYHIDG
IRVDAVSNMIYRDYDEGPWEPNHEGGNRNFEGYYFLQKLNSVIKLAHPAVVMIAEESTSE
TKITGMVEGGALGFDYKWNMGWMNDVLRFYEMDPIFRKDHLSLLSFSFMYRMQENYILPL
SHDEVVHGKKSLMHKMWGDRYKQFSQLRNLYTYMMMHPGKKLLFMGSEWGQFLEWKYDHG
LEWVDLNDAFNAKMQFFTQTLNELYKEERALWELDDQEDSLMVIDADNLDETTLTFLRQG
KTKRDFLIVVVNLTPVERHDFAIGVPYEGTYREILNTERDVFGGTWVANNPDCQTSNTPF
KQYDYQIKTILPALGALIIKPEKIKMTRKKAVKKAQKKE
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
gtggttaccaaacaacaggtactgactgcggaaaaagactttctgagtggtgaaaatttt
tatgtacagcatttcttaggcgcccatcaagtagatgatggctacgtgtttcgcgtttgg
gcaccaaatgctcagcaagtttggcttgttggcgacttcaaccaatggacggataccttg
ccgatgaacaaaaggacggaatccggtgtttgggaaattgagaccaaccaagtaaaagaa
ggacagctttacaaatacaaagtaaaacaagcaaatggacgagaagtattgaagatcgat
ccttttgctgtccattttgaagctcgaccaggaactgctgccgtgttgcattcgatccca
caaaaaaaatggcgggatgggttatggcaaggacggaaaaaaagacaaaaaacatttaat
cgacctcttaatatttatgaagttcatgccagctcctggaagcaccacgaagatggcacc
ccttatcgcttctccgaattaaaagatgaacttattccttacgtgaaaaaaatgggctac
acccatatcgaatttatgcctttgatggaacatcccttaggaacctcctggggctatcaa
ttgactggttactttgcacttagctcctattatgggacaccagaagaatttcaagacttt
gtagaggcttgtcatttggaaaatataggtgtcttcgttgattgggtgccaggacatttt
tgtgtcaatgatgacagtcttgcctattatgatggcacgccgacctttgaatacatggat
gaaaaccgtgcgaaaaatgttcgctggggtgcgatcaactttgatctaggcaaaccgcaa
gtccaaagctttctgatctcaagtgcattgttctggatcgaattttaccacattgatggt
attcgggtagatgccgtttccaacatgatctatcgcgattatgatgaaggtccatgggaa
ccgaatcacgaaggaggcaatcggaattttgaagggtactatttcttacaaaagctcaat
tcagtcatcaagttagcccatcctgcagttgtcatgattgcagaggaaagtacttccgag
accaaaataacaggaatggtcgaaggaggcgcgctcgggtttgactacaaatggaatatg
ggctggatgaatgatgtcctgcgtttttacgaaatggacccgattttccgtaaagatcat
ctaagccttttatctttttctttcatgtatcggatgcaagaaaattatatcttgccactc
tcccatgacgaagtggttcatggcaaaaaaagtttgatgcacaaaatgtggggagaccgc
tacaaacagttttcacaactacgaaatctctatacgtacatgatgatgcatccagggaaa
aaactgttattcatgggtagtgaatggggacagtttttagaatggaaatatgatcatggg
cttgaatgggtcgatttaaacgacgcattcaatgcaaaaatgcagttcttcacccagacc
ttgaatgaattgtacaaagaagaacgagccctttgggaattggatgatcaagaagattca
ttgatggtgatcgatgcagacaacttagatgaaacgacattgactttcttacgacaagga
aaaacgaaaagagatttcttgatcgtggttgtcaatctgacaccagtggagcgtcacgat
tttgcgatcggcgtgccatacgaaggaacgtatcgcgagattttaaacacggaacgggat
gtatttggtggaacttgggtggcgaataacccagactgccagaccagtaatacccctttt
aagcaatacgactatcaaatcaaaacaattttgcctgcacttggggctttaatcatcaaa
ccagaaaaaatcaaaatgactcgaaaaaaagcagtaaagaaagcacaaaaaaaagagtag

DBGET integrated database retrieval system