KEGG   Enterococcus casseliflavus: ECBG_02109Help
Entry
ECBG_02109        CDS       T02623                                 

Definition
hypothetical protein
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ecas  Enterococcus casseliflavus
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecas00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECBG_02109
   00500 Starch and sucrose metabolism
    ECBG_02109
Enzymes [BR:ecas01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     ECBG_02109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2049934..2050851)
Genome map
AA seq 305 aa AA seqDB search
MDRISKTAPPIKLKVSKEPQKGDFTSIQAAVLAAEALKAPCEITIASGVYQEQVKIYKNQ
LTLIAEPNTFLCYHLAAEQTDENGQKRGTFQTATLFINSREVFVKNLTIINDAGYGQAVG
QAVAVYIEGDDIRFERCHLDAFQDTLCLGPLPKYTKEGEPMISPWRKTIFDQQQSLFLHC
RISGTVDFIFGGGSATFEECRLHCKNTPQTNYVTAASTSKQASGLTFDRCRVTGDKAYYL
GRPWRNDAKVTFLSCCFDQQLAPCGWSDWGKTASHQTVTFTERMCCYQRSPQRPEWVTLE
GVIEK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtggatcgaatttctaaaacagcacctcctatcaagctaaaggttagtaaagagccgcaa
aagggtgattttacgagtatccaagcagccgtgctggctgctgaagccttaaaagcacct
tgtgaaatcacgatcgcctctggcgtgtatcaagaacaggtgaaaatttataaaaaccag
cttacgttgatcgcggaacctaacacgttcttatgctaccacttggctgccgagcaaacc
gatgaaaatgggcaaaaaagaggaacgtttcaaacagcgacgctctttatcaatagccga
gaagtctttgtaaaaaacctgaccatcatcaatgacgcagggtatgggcaagcagtcggg
caagcagttgccgtctatatcgaaggggatgacattcgcttcgaacgctgtcatctcgat
gcttttcaagataccttgtgcctgggtccattgccaaaatataccaaagaaggcgaacca
atgatcagtccttggcgaaagacaatctttgaccaacaacagagtttgtttttgcattgc
agaatcagtggaacagtcgattttatttttggcggtggttccgccacctttgaagagtgt
cgcttgcattgtaaaaatacaccacaaacgaactacgttactgctgcctcaaccagcaaa
caagcaagcgggttaaccttcgatcggtgccgagtgacaggggacaaagcctattattta
ggccgtccttggcgtaatgacgccaaagtcacctttttatcctgctgctttgatcaacag
ctcgccccttgcggatggtctgattggggaaaaacagcaagccaccaaacggtcacattc
acggagcgaatgtgttgttaccaaagaagtccccaacgtcctgaatgggtgactcttgaa
ggagtgatagaaaaatga

DBGET integrated database retrieval system