KEGG   Enterococcus casseliflavus: ECBG_02121Help
Entry
ECBG_02121        CDS       T02623                                 

Definition
(GenBank) alanine-synthesizing transaminase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ecas  Enterococcus casseliflavus
Pathway
ecas00220  Arginine biosynthesis
ecas00250  Alanine, aspartate and glutamate metabolism
ecas00290  Valine, leucine and isoleucine biosynthesis
ecas01100  Metabolic pathways
ecas01110  Biosynthesis of secondary metabolites
ecas01130  Biosynthesis of antibiotics
ecas01210  2-Oxocarboxylic acid metabolism
ecas01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ecas00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECBG_02121
   00290 Valine, leucine and isoleucine biosynthesis
    ECBG_02121
   00220 Arginine biosynthesis
    ECBG_02121
Enzymes [BR:ecas01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     ECBG_02121
    2.6.1.66  valine---pyruvate transaminase
     ECBG_02121
Amino acid related enzymes [BR:ecas01007]
 Aminotransferase (transaminase)
  Class I
   ECBG_02121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Arc Spherulin4 Cys_Met_Meta_PP Aminotran_MocR
Motif
Other DBs
NCBI-GeneID: 15142464
NCBI-ProteinID: EEV39852
UniProt: C9A536
Position
complement(2036032..2037249)
Genome map
AA seq 405 aa AA seqDB search
MKKFSKSSKLEGVSYDVRGPVLEEADRMQEEGISILKLNTGNPAPFGFEAPNEIVRDLIM
NVRESEGYSDSKGIFSARKAIEQYYQLQKFPDVTINDIYTGNGVSELITMCMQGLCNNGD
EVLVPMPDYPLWTASISLAGGKPVHYICDEQADWNPDIEDIKAKVTSKTKAIVIINPNNP
TGAVYPKEVLQQIVEVAREHDLIIFSDEIYDRLVMDDYVHVPIATLAPDRFVVTLGGLSK
SHRVAGFRVGWMVLSGDKSNVKDYIEGLNMLSSMRLCSNVLSQQIVQTALGGYQSSDELL
LPGGRIYEQREFIYKAINDIPGLSAVKPKAAFYIFPKIDIQRFNITNDEQFVLDFLHEHH
ILLVHGGGFNWQQPDHFRIVYLPNMEDLKTTAEKMTEFLAAYRQK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaattttcgaagtcgtcaaaacttgaaggggtcagttatgatgtacgcggccct
gttttagaagaagctgatcggatgcaagaagaaggcatcagtatcttaaaattaaatacg
gggaatcccgcgccctttggctttgaagccccaaatgaaatcgttagagatttgattatg
aatgtgcgagagtcggaaggctattctgattcaaaagggattttctcggcccgtaaagcg
atcgagcaatattatcaattacaaaaatttcctgatgtgaccatcaatgatatttacaca
ggtaatggtgtttccgagctgatcacgatgtgtatgcaagggttatgtaacaatggggac
gaagtgctcgtgccgatgccagactatcccttgtggactgcttcgatctcattagctggc
ggaaaacccgtccattatatttgtgatgaacaagcagattggaatcctgatatcgaggat
atcaaagccaaagtaaccagcaagacgaaggccatcgtcattattaatccaaataatccc
accggcgccgtttatccgaaagaagttttgcaacaaatcgtcgaggttgctcgtgagcat
gacttgatcattttctccgatgagatctatgaccgtttagtcatggatgattatgtccat
gtaccgattgctacgctagcaccagatcgcttcgttgtgacgctaggcggtttgtctaag
tctcaccgagtggcaggcttccgcgttggctggatggttctcagcggggataagtccaat
gtcaaagactatatcgaaggcttgaatatgttgtcttcgatgcggctgtgttccaatgtt
ttatcgcaacaaatcgtccaaactgcattaggcggctatcaaagctccgatgagctgctg
ctgccaggtggtcgaatctatgaacaaagagagtttatctacaaggcgatcaatgatatt
cctggattgtcagcagtgaaaccgaaagcagccttttatatttttcctaaaattgatatt
cagcgctttaacattaccaatgatgaacaatttgttctcgactttttacatgaacaccat
atcttgttggtgcacggcggtgggttcaattggcaacagcccgatcatttccgtatcgtc
taccttcctaatatggaagatttaaaaacgactgctgaaaaaatgacagaattcttggca
gcgtatcgccagaagtaa

DBGET integrated database retrieval system