KEGG   Enterococcus casseliflavus: ECBG_02355Help
Entry
ECBG_02355        CDS       T02623                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
ecas  Enterococcus casseliflavus
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecas00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ECBG_02355
Enzymes [BR:ecas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     ECBG_02355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3039982..3040575)
Genome map
AA seq 197 aa AA seqDB search
MGEMAQLFFKYGAMNSGKTIEILKVAHNYEEQDKPVVIMTSGLDTRSGVGNVSSRIGLER
DAIPIFDETDLFHLIKDLGYKPYCILIDEAQFLKKHHVLAFTKIVDELGIPVMAFGLKND
FRNELFEGSKYLLLYADKIEEMKTICWFCHKKATMNLHYIDGKPVYEGDQVQIGGNEAYY
PVCRKHYFHPGMKKEGE
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagatggcacagcttttttttaaatatggcgcaatgaatagtgggaaaacgatc
gagatactgaaagttgctcacaactatgaagaacaagacaaaccagtcgtgatcatgaca
agtggattggacacgagaagcggtgtgggaaatgtttcgagccgcatcggcttagaacga
gacgcgatcccgatttttgatgaaacggatctgttccatttgatcaaagacctcggttac
aaaccttattgtattttgatcgacgaagcacagttcctaaagaagcatcacgtgttggct
ttcaccaaaatcgtggacgagctaggtatccctgtgatggcctttggtttgaaaaatgat
ttccgcaatgaattatttgaaggctcaaaatacttgctgctttatgcagataaaatcgaa
gagatgaaaaccatctgctggttctgtcataaaaaagcaaccatgaacttgcactatatc
gacggaaaacccgtttacgagggcgaccaagtacaaatcggcggtaacgaagcgtattat
cctgtttgccgcaaacattactttcacccgggaatgaaaaaagaaggagaataa

DBGET integrated database retrieval system