KEGG   Enterococcus casseliflavus: ECBG_02606Help
Entry
ECBG_02606        CDS       T02623                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
ecas  Enterococcus casseliflavus
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecas00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECBG_02606
   00051 Fructose and mannose metabolism
    ECBG_02606
Enzymes [BR:ecas01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     ECBG_02606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2767026..2768333)
Genome map
AA seq 435 aa AA seqDB search
MTYFPEIEKIRYEGPKTDNMFAFRHYDAEEVVLGKKMKDHLRFAIAYWHTMTQDGSDPFG
APVNKRTWIGDTEMETAKNRVEAFFEICEKLGAEFFCFHDVDVAPAGETLEEFFQNLDEI
TDLIKEKMEQTGIKLLWNTANMFSHPRFNNGAASTNNAEVYAYAAAQVKKGLDISKKLGG
ENYVFWGGREGYETLLNTDMKFEQDNIARLFKMAIAYGEKIGHKPQFLLEPKPKEPSKHQ
YDFDAATTMAFIQHYGLEGDFKLNLEANHATLAGHTFEHEIAVARSYNALGSLDANQGDM
LLGWDTDEFPTNVFDSTLALYEVLENGGIAPGGINFDSKVRRSSFEMEDLLLAHIAGMDT
YARALKAAAKLKEDRFLDELKEKRYASFQEGIGAKIVADEESLETLTDYALAHDQIELES
SHIEYVKSRLNDYLF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgacttatttcccagagatcgaaaaaatccgctacgaaggtcctaaaacagacaatatg
tttgcatttcgccactacgatgccgaagaagttgttttaggcaagaaaatgaaagatcat
ctacgttttgcaatcgcctattggcatacgatgacgcaagacggctctgatcctttcggc
gcacctgtcaacaaacggacgtggatcggtgacaccgaaatggaaacggcgaaaaatcga
gtagaagctttctttgagatttgcgaaaaattaggggcagagttcttctgtttccatgat
gttgacgtggcacctgcaggagaaacgttagaagaatttttccaaaacttagacgaaatc
accgatttgatcaaagaaaaaatggaacaaacgggaatcaaactattatggaatacagca
aatatgttctcacatcctcgtttcaataacggcgctgcttccaccaataatgcggaagtt
tatgcgtatgcggcagcccaagtcaaaaaaggcttagacatctcgaaaaaattaggcggc
gaaaactatgtcttctggggtggccgtgaaggttatgaaaccttgttgaatacagacatg
aaatttgaacaagacaatatcgcccgtctattcaaaatggcgatcgcttatggcgaaaaa
atcggtcataaaccgcagttcttattagagccgaaaccaaaagaaccatcaaaacatcaa
tatgattttgatgcagcgacaacgatggcgttcattcagcactacggcttagaaggagat
ttcaaattaaacctagaagccaatcatgcaacattagctggccatacctttgaacatgaa
atcgccgttgcccgtagctataacgcattaggctcactggatgccaaccaaggagatatg
ctgttagggtgggatacggatgaattcccaaccaacgtctttgactcgacacttgcttta
tacgaagtcttagaaaacggcggcatcgcgccgggaggaatcaatttcgattctaaagtc
cgtcgttcgtcatttgaaatggaagatctgttgttagcccacatcgctggtatggatacg
tatgcccgagcgttgaaagcagcagcgaaactaaaagaagaccgcttcttagacgagttg
aaggaaaaacggtacgcctctttccaagaaggcatcggagcgaagatcgttgctgatgag
gaaagcttagaaacactgacagattacgcattggctcatgatcaaatcgaattagaatcc
agccacattgaatatgtgaaatctcgtttgaatgattacctgttttaa

DBGET integrated database retrieval system