KEGG   Enterococcus casseliflavus: ECBG_02781Help
Entry
ECBG_02781        CDS       T02623                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
ecas  Enterococcus casseliflavus
Brite
Enzymes [BR:ecas01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     ECBG_02781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2582186..2582938)
Genome map
AA seq 250 aa AA seqDB search
MKTFNQPKPVFAEHGKRAVILFHAYSGSPNDVRMLCRSLEQKDYTVYTPMFTGHGTPNPD
DILNQGMTVWQQDAADAVAYVKEKGYEEVAVLGLSMGGILAMDRLTQDPTLMGGGLFCSP
LFETKNEVPVNFEKYAEMVIPYADLDEAIQKEILAEVPRKVREQLQGIETVGQTTAEHLG
KIERPIFLAQAGRDQMIDPQTVFKTAAALSHVPYTLQWYPQSGHVVTVGPERKKLEQDVF
AFLETLAWKE
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacatttaatcaaccaaaaccggtttttgctgaacacggcaaacgagcggtcatt
ttgttccatgcctattcaggcagtcctaacgatgtgcgcatgctttgtcgttcgttagaa
caaaaagactacacggtgtatacaccgatgtttactggacatggtacaccgaatccagat
gatatcttaaatcaaggaatgactgtttggcagcaggatgctgcggatgcagttgcttat
gtgaaagaaaaaggctatgaggaagttgccgttcttggactttcgatgggtggaatttta
gcgatggatcgtttgacgcaagacccaacattgatgggcggcggtcttttttgctcaccg
ttatttgaaaccaagaacgaagtaccagtcaattttgaaaagtatgctgaaatggtcata
ccctacgctgatttagatgaggcgatccaaaaagaaatattggcagaagtccctcgtaag
gtcagagaacaactgcaaggaatcgaaacagtcggacaaaccacagctgagcatttagga
aaaatcgagcgcccaatcttcctggcgcaagcaggaagggaccaaatgatcgatccacag
acggttttcaaaaccgcagcggcattgtcccatgttccctatacgcttcaatggtatcct
caaagtggtcatgtggtgacggttggaccagaacggaaaaaattagagcaggatgtgttt
gctttcttagaaacacttgcttggaaagagtga

DBGET integrated database retrieval system