KEGG   Equus caballus (horse): 100009710Help
Entry
100009710         CDS       T01058                                 

Gene name
PRKAA1
Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-1
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04068  FoxO signaling pathway
ecb04140  Autophagy - animal
ecb04150  mTOR signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04152  AMPK signaling pathway
ecb04211  Longevity regulating pathway
ecb04213  Longevity regulating pathway - multiple species
ecb04371  Apelin signaling pathway
ecb04530  Tight junction
ecb04710  Circadian rhythm
ecb04714  Thermogenesis
ecb04910  Insulin signaling pathway
ecb04920  Adipocytokine signaling pathway
ecb04921  Oxytocin signaling pathway
ecb04922  Glucagon signaling pathway
ecb04931  Insulin resistance
ecb04932  Non-alcoholic fatty liver disease (NAFLD)
ecb05410  Hypertrophic cardiomyopathy (HCM)
ecb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    100009710 (PRKAA1)
   04068 FoxO signaling pathway
    100009710 (PRKAA1)
   04151 PI3K-Akt signaling pathway
    100009710 (PRKAA1)
   04152 AMPK signaling pathway
    100009710 (PRKAA1)
   04150 mTOR signaling pathway
    100009710 (PRKAA1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100009710 (PRKAA1)
  Cellular community - eukaryotes
   04530 Tight junction
    100009710 (PRKAA1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100009710 (PRKAA1)
   04922 Glucagon signaling pathway
    100009710 (PRKAA1)
   04920 Adipocytokine signaling pathway
    100009710 (PRKAA1)
   04921 Oxytocin signaling pathway
    100009710 (PRKAA1)
  Aging
   04211 Longevity regulating pathway - mammal
    100009710 (PRKAA1)
   04213 Longevity regulating pathway - multiple species
    100009710 (PRKAA1)
  Environmental adaptation
   04710 Circadian rhythm
    100009710 (PRKAA1)
   04714 Thermogenesis
    100009710 (PRKAA1)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100009710 (PRKAA1)
   05410 Hypertrophic cardiomyopathy (HCM)
    100009710 (PRKAA1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100009710 (PRKAA1)
   04931 Insulin resistance
    100009710 (PRKAA1)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100009710 (PRKAA1)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   100009710 (PRKAA1)
Membrane trafficking [BR:ecb04131]
 Autophagy
  Other autophagy associated proteins
   Others
    100009710 (PRKAA1)
Mitochondrial biogenesis [BR:ecb03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100009710 (PRKAA1)
  Mitophagy factors
   Other mitophagy factors
    100009710 (PRKAA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr AdenylateSensor Kinase-like RIO1 Kdo APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 100009710
NCBI-ProteinID: NP_001075272
Ensembl: ENSECAG00000022617
UniProt: K9K2H2 Q2LGG0
Position
21
AA seq 559 aa AA seqDB search
MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNR
QKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNG
RLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEF
LRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDG
IFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMID
DEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDS
FLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDI
MAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDE
ITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEASLTSSVTSLDSSPVDLTPRPG
SHTIEFFEMCANLIKILAQ
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagactcagttcctggagaaagatggcgacagccgagaagcagaaacacgacggg
cgggtgaagatcggccactacatcctgggggacacgctgggggtcggcacgttcggcaaa
gtgaaggttggcaaacatgaattgactgggcataaagttgctgtgaagatactcaatcgc
cagaagattcgaagcctcgatgtggttggaaaaatccgcagagaaattcagaacctcaag
cttttcaggcatcctcatataattaaactgtaccaggtcatcagtacaccatctgatatt
ttcatggtgatggaatatgtctcaggaggagagctatttgattatatctgtaaaaatgga
aggctcgatgaaaaagaaagtcgacgtctgttccaacagatcctttctggtgtggattat
tgtcacaggcatatggtggtccatagagacttgaaacctgaaaacgtcctgcttgatgca
cacatgaatgcaaagatagctgattttggtctttcaaacatgatgtcagatggtgaattt
ttaagaacgagttgtggctcacccaactatgctgccccagaggtcatttcaggaagattg
tatgcaggcccagaggtagacatatggagcagcggggttattctctatgctttattatgt
ggaacccttccatttgatgatgatcatgtgccaactctttttaagaagatatgtgatggg
atcttttatacccctcagtatttaaatccatccgtgattagccttttgaaacatatgctg
caggtggatcccatgaagcgggccacaatcaaagatatcagggaacatgaatggtttaaa
caagaccttccaaaatatctctttcctgaggacccatcatatagttcaactatgattgat
gatgaagccttaaaagaagtatgtgaaaaatttgaatgctcagaagaggaggttctcagc
tgcctttataaccgaaatcaccaggaccctttggcagtggcctaccacctcatcatagat
aacaggagaataatgaatgaagccaaagatttttacttggcgacaagcccacctgattct
tttcttgatgatcaccatttgactcggccccatcctgaaagagtaccattcttggttgct
gaaacaccaagggcacgccatactctcgatgaattaaatccacagaaatccaaacaccaa
ggtgtaagaaaagccaaatggcatttgggaattagaagtcaaagtcgaccaaatgatatc
atggcagaagtttgtagagcaattaaacaactggattatgaatggaaggttgtaaaccca
tattacttgcgtgttcgaaggaagaatcctgtgacaagtacctactccaaaatgagtcta
cagttataccaagtggacagtagaacatacttactggatttccgtagtattgatgatgaa
attactgaagccaaatccgggactgctactccacaaagatcgggatccgttagcaactat
cgatcttgtcagaggagtgattcggatgctgaggctcaaggaaaatcctcagaagcttct
cttacctcatcggtgacctcacttgactcttctcctgttgacttaactccaagacctgga
agtcacacaatagagttttttgagatgtgtgcgaatctaattaaaattcttgcacagtaa

DBGET integrated database retrieval system