KEGG   Equus caballus (horse): 100009712Help
Entry
100009712         CDS       T01058                                 

Gene name
CYP19A1, P450AROM
Definition
cytochrome P450, family 19, subfamily A, polypeptide 1 (EC:1.14.14.14)
Orthology
K07434  
aromatase [EC:1.14.14.14]
Organism
ecb  Equus caballus (horse)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Ovarian steroidogenesis
Module
C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100009712 (CYP19A1)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    100009712 (CYP19A1)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.14  aromatase
     100009712 (CYP19A1)
Cytochrome P450 [BR:ecb00199]
 Cytochrome P450, animal type
  CYP19 family
   100009712 (CYP19A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 503 aa AA seqDB search
MILEMLNPMHYNLTSMVPEVMPVATLPILLLTGFLFFVWNHEETSSIPGPGYCMGIGPLI
SHLRFLWMGLGSACNYYNKMYGEFVRVWISGEETLVISKSSSTFHIMKHDHYSSRFGSTF
GLQYMGMHENGVIFNNNPAVWKALRPFFVKALSGPSLARMVTVCVESVNNHLDRLDEVTN
ALGHVNVLTLMRRTMLDASNTLFLRIPLDEKNIVLKIQGYFDAWQALLIKPNIFFKISWL
SRKHQKSIKELRDAVGILAEEKRHRIFTAEKLEDHVDFATDLILAEKRGELTKENVNQCI
LEMMIAAPDTLSVTVFFMLCLIAQHPKVEEALMKEIQTVLGERDLKNDDMQKLKVMENFI
NESMRYQPVVDIVMRKALEDDVIDGYPVKKGTNIILNIGRMHKLEFFPKPNEFTLENFEK
NVPYRYFQPFGFGPRSCAGKFIAMVMMKVMLVSLLRRFHVKTLQGNCLENMQKTNDLALH
PDESRSLPAMIFTPRNSEKCLEH
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgattttggaaatgctaaacccgatgcattataacctcaccagcatggtgcccgaagtc
atgcctgtcgccaccttgcccattctgctgctcactggctttcttttctttgtttggaat
catgaagaaacatcctcaataccaggccctggctattgcatgggaatcgggcccctcatt
tcccacctccggttcctgtggatggggcttggcagtgcctgcaactactacaacaagatg
tatggagaattcgtgagagtctggatcagtggagaggaaacgctcgttattagcaagtcc
tcaagtaccttccacatcatgaaacacgatcactactcctcccgatttggcagcacattt
gggttgcagtatatgggcatgcatgagaatggcgtcatatttaacaataacccagccgtc
tggaaagctttgcgacctttctttgtaaaagctttgtctggccccagccttgcgcgcatg
gtgacagtttgtgttgaatccgtcaacaaccatctggacaggttggacgaggtcaccaat
gcgttgggccatgtcaacgtgttgaccctcatgcgacgtaccatgctggacgcttccaac
accctcttcctgaggatccccttggacgagaaaaacatcgtgcttaaaatccagggttat
tttgatgcatggcaggctctccttatcaaaccaaacatcttctttaagatttcttggcta
tccagaaagcatcaaaagtccatcaaagaattgagagatgccgtgggaattctagcagaa
gaaaaaagacacaggattttcacagcagagaaactggaagaccatgtggattttgccact
gatctaattttggctgagaaacgtggtgagctgaccaaagagaatgtgaaccagtgcata
ttggaaatgatgattgcagcgccagacaccttgtctgtcactgtgttcttcatgctatgt
ctcattgcgcagcaccctaaagttgaagaggcactcatgaaggaaatccagactgttctt
ggtgaaagagacttaaagaatgatgatatgcaaaaattaaaagtgatggaaaattttatt
aatgagagcatgcggtaccagcctgtcgtggacattgtcatgcgcaaagccttagaggat
gatgtcatcgatggctatccagtgaaaaaggggactaacattattctgaatattggaaga
atgcataaactcgagtttttccccaagcctaatgaatttactcttgaaaactttgagaag
aatgttccttacaggtattttcagccatttggttttgggccccgtagctgcgctggaaag
ttcatcgccatggtgatgatgaaggtgatgctggtttcacttctgagacgattccatgtg
aagacattacaaggaaactgtcttgaaaatatgcagaaaacaaatgacttggccctccac
ccggatgagtctagaagcttaccggcaatgatttttactccaagaaattcagaaaagtgc
ctcgaacactaa

DBGET integrated database retrieval system