KEGG   Equus caballus (horse): 100033839Help
Entry
100033839         CDS       T01058                                 

Gene name
VEGFA, VPF
Definition
(RefSeq) vascular endothelial growth factor A
  KO
K05448  
vascular endothelial growth factor A
Organism
ecb  Equus caballus (horse)
Pathway
EGFR tyrosine kinase inhibitor resistance
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
HIF-1 signaling pathway
PI3K-Akt signaling pathway
VEGF signaling pathway
Focal adhesion
Relaxin signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Human papillomavirus infection
Kaposi's sarcoma-associated herpesvirus infection
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Renal cell carcinoma
Pancreatic cancer
Bladder cancer
Rheumatoid arthritis
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100033839 (VEGFA)
   04015 Rap1 signaling pathway
    100033839 (VEGFA)
   04370 VEGF signaling pathway
    100033839 (VEGFA)
   04066 HIF-1 signaling pathway
    100033839 (VEGFA)
   04151 PI3K-Akt signaling pathway
    100033839 (VEGFA)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100033839 (VEGFA)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100033839 (VEGFA)
 Organismal Systems
  Endocrine system
   04926 Relaxin signaling pathway
    100033839 (VEGFA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100033839 (VEGFA)
   05206 MicroRNAs in cancer
    100033839 (VEGFA)
   05205 Proteoglycans in cancer
    100033839 (VEGFA)
   05212 Pancreatic cancer
    100033839 (VEGFA)
   05211 Renal cell carcinoma
    100033839 (VEGFA)
   05219 Bladder cancer
    100033839 (VEGFA)
  Immune diseases
   05323 Rheumatoid arthritis
    100033839 (VEGFA)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100033839 (VEGFA)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100033839 (VEGFA)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100033839 (VEGFA)
   05165 Human papillomavirus infection
    100033839 (VEGFA)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100033839 (VEGFA)
Cytokines [BR:ecb04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass I
    100033839 (VEGFA)
Cell adhesion molecules and their ligands [BR:ecb04516]
 7. Others
  NRP1; neuropilin 1 [KO:K06724]
   100033839 (VEGFA)
  NRP2; neuropilin 2 [KO:K06819]
   100033839 (VEGFA)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   100033839 (VEGFA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
20
AA seq 190 aa AA seqDB search
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGEHKTHEVVKFMDVYQRSYCRPIETLVDI
FQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTAEFNITMQIMRIKPHQSQHIGEMS
FLQHSKCECRPKKDKARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNE
RTCRCDKPRR
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaactttctgctctcttgggtgcattggagccttgccttgctgctctacctccaccat
gccaagtggtcccaggctgcacccatggcagaaggagagcataaaacccatgaagtggtg
aagttcatggacgtctaccagcgcagctactgccgtccaatcgagaccctggtggacatc
ttccaggagtaccccgatgagatcgagtacatcttcaagccatcctgtgtgcccctgatg
cggtgtgggggctgctgcaacgacgagggcctagagtgcgtgcccactgcggagttcaac
atcaccatgcagattatgcggatcaaacctcaccaaagccaacacataggagagatgagt
ttcctacagcatagcaaatgtgaatgcagaccaaagaaagataaagcaaggcaagaaaat
ccctgtgggccttgctcagagcggagaaagcatttgtttgtacaagatccgcagacgtgt
aaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcagcttgagttaaacgaa
cgtacttgcagatgtgacaagccgaggcggtga

DBGET integrated database retrieval system