KEGG   Equus caballus (horse): 100033911Help
Entry
100033911         CDS       T01058                                 

Gene name
COMP
Definition
cartilage oligomeric matrix protein
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
ecb  Equus caballus (horse)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100033911 (COMP)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100033911 (COMP)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100033911 (COMP)
  Cellular commiunity
   04510 Focal adhesion
    100033911 (COMP)
 Human Diseases
  Infectious diseases
   05144 Malaria
    100033911 (COMP)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100033911 (COMP)
  Exosomal proteins of colorectal cancer cells
   100033911 (COMP)
  Exosomal proteins of bladder cancer cells
   100033911 (COMP)
Heparan sulfate/heparin binding proteins [BR:ecb00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  100033911 (COMP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
21
AA seq 755 aa AA seqDB search
MVLSAAPVLLLALAALVSSQGQTPLGTELGPQMLRELQETNAALQDVRELLRQQVKEITF
LKNTVMECDACGMQPARTPRVSVRPLAQCAPGSCFPGVACTQTASGARCGPCPAGFTGNG
PYCADVNECNANPCFPRVRCINTSPGFRCEACPPGYSGPTHEGVGMAFAKANKQVCTDID
ECETGQHNCVPNSVCINTQGSFQCGPCQPGFVGDQASGCRPRAQRFCPDGTPSPCHEKAD
CVLERDGSRSCVCAVGWAGNGLLCGRDTDLDGFPDEKLRCSERQCRKDNCVTVPNSGQED
ADRDGIGDACDTDADGDGVPNEGDNCPLVRNPDQRNTDGDKWGDACDNCRSQKNDDQKDT
DQDGRGDACDDDIDGDRIRNAVDNCPRVPNSDQKDSDGDGIGDVCDNCPQKSNPDQRDVD
HDFVGDACDSDQDKDGDGHQDSRDNCPTVPNSAQQDSDSDGQGDACDEDDDNDGVPDSRD
NCRLVPNPGQEDADRDGVGDVCQGDFDADKVVDKIDVCPENAEVTLTDFRAFQTVVLDPE
GDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFIFG
YQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDTAS
QVRLLWKDPRNVGWKDKTSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRGGRL
GVFCFSQENIIWANLRYRCNDTIPEDYEIQRLLQA
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atggttctctccgccgcccccgttctcctgctcgccctggccgccctcgtgtccagccag
gggcagaccccgctgggtacagaactgggcccacagatgctgcgcgaactgcaagagacc
aacgcggcgctgcaggacgtgcgggagctgctgcggcagcaggtcaaggagatcacgttc
ctgaaaaacacggtgatggagtgtgacgcgtgcgggatgcagcctgcgcgcaccccccgc
gtgagcgtgcggcccctagcccagtgcgcgccgggctcctgcttccctggcgtggcttgt
acccagacggcgagcggcgcgcgctgcggaccctgccccgcgggcttcacgggcaacggc
ccatactgtgccgacgtcaacgagtgcaacgccaatccctgcttccctcgcgtccgctgc
atcaataccagccccggtttccgctgcgaggcttgcccgcccgggtacagcggccccacc
cacgagggcgtggggatggcctttgccaaggccaacaagcaggtttgcacggatattgac
gagtgtgagaccgggcagcataactgcgtccccaactccgtgtgcatcaacacccagggc
tccttccagtgcggcccgtgccagcccggcttcgtaggcgaccaggcatcaggctgccgt
ccgcgcgcacagcgcttctgccccgacggcacgcccagcccgtgccacgagaaggccgac
tgcgtcctggagcgcgatggctcgcgatcgtgcgtgtgcgccgtcggctgggccggcaac
gggctcctgtgtggccgcgacacggacttggacggcttcccggacgagaagctgcgctgc
tcggagcgccagtgtcgcaaggataactgcgtgacggtacccaactcaggacaggaggac
gcggatcgcgacggcatcggagacgcctgcgacacggacgccgacggagacggagtcccc
aacgagggggacaactgcccgctggtgcggaacccagaccagcgtaacacggacggcgac
aagtggggcgatgcatgcgacaactgccggtcccagaagaacgatgaccagaaggacaca
gatcaggacggccgaggcgacgcctgcgacgatgacatcgacggcgaccggatccgaaat
gcggtggacaactgccccagggtgcccaactcagaccagaaagacagtgatggcgatggt
ataggggatgtctgtgacaactgtccccagaagagcaacccagaccagagggacgtggac
cacgacttcgtgggagacgcttgtgacagcgaccaagacaaggatggggatgggcaccag
gactctcgggacaattgccccacagtgcccaacagcgcccagcaggactcagacagcgat
ggtcagggtgacgcctgcgacgaggatgacgacaacgacggggtccccgacagtcgggac
aactgccgcctggtgcccaacccgggccaggaagacgctgaccgggacggtgtgggcgac
gtgtgccagggcgacttcgacgcagacaaggtggtggacaagattgatgtgtgtccggag
aacgccgaagtcaccctcaccgacttccgggccttccagacggttgtgttggaccccgag
ggcgacgcgcaaatagaccccaactgggtggtgctcaaccaggggatggagatcgtgcaa
acaatgaacagcgaccctggcctggctgtgggttacacggccttcaatggcgtggacttc
gaaggcacgttccacgtgaatacggtcacagatgacgactacgcgggcttcatctttggc
taccaggacagctctagcttctacgtggtcatgtggaagcagatggagcagacgtattgg
caggcgaaccccttccgagccgtagccgagcccggcatccagctgaaggccgtgaagtcc
tccacaggccctggggagcagctgcggaatgcactgtggcacacgggggacacagcatca
caggtgcggctgctatggaaggacccccgcaacgtgggctggaaggacaagacatcctac
cgctggttcctacaacaccggccccaagtgggctacatcagagtgcggttctatgagggc
cctgagctggtggccgacagcaacgtggtcttggacacgaccatgcggggcggccgccta
ggagtcttctgcttctcccaggagaacatcatctgggccaacctgcgctaccgctgcaat
gacaccatccccgaggactacgagatccagcggttgctgcaggcctag

DBGET integrated database retrieval system