KEGG   Equus caballus (horse): 100034015Help
Entry
100034015         CDS       T01058                                 

Gene name
TMSB4X
Definition
(RefSeq) thymosin beta-4
  KO
K05764  thymosin, beta 4
Organism
ecb  Equus caballus (horse)
Pathway
ecb04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100034015 (TMSB4X)
Cytoskeleton proteins [BR:ecb04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Thymosin
     100034015 (TMSB4X)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thymosin WH2 DUF4522
Motif
Other DBs
NCBI-GeneID: 100034015
NCBI-ProteinID: NP_001157420
Ensembl: ENSECAG00000009190
UniProt: P62327
Position
X
AA seq 44 aa AA seqDB search
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaacccgatatggctgagattgagaaattcgataagtccaaattgaagaag
acggaaacgcaagagaaaaatccactgccttcaaaagaaacgattgaacaggagaagcaa
gcaggcgaatcgtaa

DBGET integrated database retrieval system