KEGG   Equus caballus (horse): 100034051Help
Entry
100034051         CDS       T01058                                 

Gene name
ARG2
Definition
(RefSeq) arginase, type II
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
ecb  Equus caballus (horse)
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of antibiotics
Biosynthesis of amino acids
Amoebiasis
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100034051 (ARG2)
  Amino acid metabolism
   00220 Arginine biosynthesis
    100034051 (ARG2)
   00330 Arginine and proline metabolism
    100034051 (ARG2)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    100034051 (ARG2)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     100034051 (ARG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
24
AA seq 352 aa AA seqDB search
MSLGSSLSRLLRTQVHSVLKKAVHSVAVIGAPFSGGQKRKGVEHGPAAVREAGLMKRLSN
LGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSKAVSGGYSCVTVGGDH
SLAIGTISGHARHCPDLCVIWVDAHADINTPLTTSSGNLHGQPVSFLLRELQEEVPQLPG
FSWIKPCISSPSIVYIGLRDVDPAEHFILKNYDIQYFSMRDIDRLGIQKVMEQTFDLLIG
KRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGIYITEEIHNTGLLSALDLVEVNPW
VAASEEEAKATAVLAVDVIASSFGQTREGGHTVYDQLPTXPDESQSEELVRI
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtccctggggagcagcctctcgcgtctcctccggacgcaagtgcattccgtcctgaag
aaggccgtccactccgtggctgtgatcggagccccgttctcagggggacagaagagaaaa
ggagtggaacatggtcccgctgctgtaagagaagctggcttgatgaaaaggctctccaat
ttgggttgtcacctaaaagactttggcgatttgagttttactcctgtccccaaagatgat
ctctacaacaacctgatagtgaatcctcgctcagtgggccttgccaaccaggaactggct
gaggtggttagtaaagccgtgtcaggtggctacagctgtgtcacagtgggaggggaccac
agcctggcaattggtaccattagtggccacgcccggcactgcccagacctttgtgtgatc
tgggttgatgcccatgctgacatcaatacaccgctcaccacttcatctggaaatctccac
gggcagccagtttcattcctcctcagagaactacaggaggaggtaccacaactcccagga
ttttcctggatcaaaccttgtatttcttccccaagtattgtgtatattggtctaagagat
gtggaccctgctgaacattttattttaaagaattatgatatccagtatttttccatgaga
gacatagatcgacttggtatccagaaggtcatggaacagacatttgatctgctgattggc
aaaagacaaaggccaatccatctgagttttgatatcgatgcatttgaccctacactggct
ccagccacaggaacccctgttgtagggggactgacttatcgagaaggcatatatattact
gaggaaatacacaatacagggttgctgtcagcactggatcttgttgaagtcaatccttgg
gtggctgcttcagaggaagaggccaaggctacggctgtcctagcagtggatgtgattgct
tcaagttttggtcagacaagggagggagggcacactgtctatgaccaacttcctactnca
ccagatgaatcacaaagtgaagaacttgtgagaatttag

DBGET integrated database retrieval system