KEGG   Equus caballus (horse): 100034079Help
Entry
100034079         CDS       T01058                                 

Gene name
GPX5
Definition
glutathione peroxidase 5 (epididymal androgen-related protein)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ecb  Equus caballus (horse)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Thyroid hormone synthesis
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ecb00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ecb00480]
Organismal Systems; Endocrine system; Thyroid hormone synthesis [PATH:ecb04918]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
20
AA seq 224 aa AA seqDB search
MTAQLRASYLFLLLLAGFVQTENNAEKMKTDCYKDVKDTIYEYSAVTLNGKEHIQFNQYA
GKPVLFVNVATYCGLTAQYPELNTLQEELKPFDLVVLGFPCNQFGKQEPGENSEILPGLK
YVRPGGGYVPNFQLFEKGDVNGEKEQKVFTFLKHSCPHPSDVLGSLKHISWEPIKVHDIR
WNFEKFLVGPDGVPVMRWFHKTPVSTVKSDILAYLKQFKIKKGG
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgactgcacagttaagggcctcctatcttttcctccttctcctagcaggctttgtgcag
acagaaaacaatgcagagaagatgaagacagattgctacaaagatgtgaaagacaccatc
tatgaatatagcgccgtcactcttaatggaaaggaacacattcagttcaatcagtatgcg
ggcaagcctgtcctttttgtcaatgtggccacttattgtggtctgactgctcaatatcct
gaactgaacacacttcaggaggagctgaagcccttcgacttagtagtgctgggcttcccc
tgcaaccaatttggaaagcaagaaccaggagagaactcagagatccttccggggctgaag
tatgtccgtccggggggaggatatgtacctaatttccagctttttgagaaaggagatgtg
aatggtgaaaaagaacagaaagtcttcaccttcttgaagcactcctgtcctcacccctct
gatgttttgggctcattaaaacatatatcctgggaacctataaaggtccatgacatccgc
tggaattttgaaaagttcctggtggggcctgatggagtccctgtcatgcgctggttccat
aagactccggtcagtacagtcaagtcagatatcctggcgtacctgaagcagttcaaaatt
aaaaagggaggctga

DBGET integrated database retrieval system