KEGG   Equus caballus (horse): 100034130Help
Entry
100034130         CDS       T01058                                 

Gene name
GALC
Definition
galactosylceramidase
Orthology
K01202  
galactosylceramidase [EC:3.2.1.46]
Organism
ecb  Equus caballus (horse)
Pathway
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ecb00600]
Cellular Processes; Transport and catabolism; Lysosome [PATH:ecb04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
24
AA seq 685 aa AA seqDB search
MAESLLQASRQRRAKAMTAAAGSAGRAAVSLLLCALLAPAGAYVLDDSDGLSRELDGIGA
VSGGGATSRLLVNYPEPYRSQILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYA
LDENYFRGYEWWLMKEAKKRNPNITLMGLPWSFPGWLGKGFNWPYVNLQLTAYYVVSWIV
GAKYYHDLDIDYIGIWNERTFDSDYIKVLRRMLNYQGLQQVKIIASDNLWEPIAASMLLD
PELLKVIDVIGAHYPGTHTVKDARLTEKKLWSSEDFSTLNNDVGAGCWARVLNQNYINGY
MTSTIAWNLVASYYEQLPYGRCGLMTAQEPWSGHYVVESPIWISAHTTQFTQPGWYYLKT
VGHLEKGGSYVALTDGLGNLTIIIETMSHKQSKCIRPFLPYFNVSRQYATFILKGSFSEI
PGLQVWYTKLGKPSERFLFKQLDSLWLPDGSDSFTLELQADELFTLTTLTAGTKGSYPVP
PRSQPFPRIYKDDFNVDYPFFTEAPNFADQTGVFEYFTNMEDPGEHRFTLRQVLNQRPIT
WAADAYNTISVIGDYKWSNVTIKCDVYIETPQTGGVFIAGRVNKGGILIRSARGVFFWIF
ANGTYRVTGDLAGWMIYALGQADIRAKKWYTLTLTIKGHFSSGMLNGKPLWTNVPVNFPK
NGWAAIGTHFFEFAQFDNFYVEAMG
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggctgagagcctactccaggcttcccggcaacgccgagcgaaagccatgacggcagcc
gcgggttcggcgggccgcgccgccgtgtccctgctgctgtgtgcgctgttggcgcccgcc
ggcgcgtacgtgctcgacgactccgacgggctgagccgggagttagatggcatcggcgcg
gtcagcggcggcggggcaacttcccggcttctagtaaattacccagagccctatcgttct
caaatattggattatctctttaagccaaacttcggtgcctctttgcatattctaaaagtc
gaaataggtggtgatgggcagacaacagacggcactgagccctcccacatgcactatgca
ctagatgagaattacttccgaggatatgagtggtggttaatgaaggaagctaagaagcgg
aaccctaacattacgctcatggggttgccgtggtccttccctggatggctgggaaaaggt
ttcaactggccctatgtaaatcttcagctgactgcctactatgtcgtgagctggattgtg
ggtgccaagtattatcatgatttggacattgattatattgggatttggaatgagaggaca
tttgatagcgattatatcaaggtgttaagaagaatgctcaactatcaaggtctccagcaa
gtgaaaatcatcgcgagtgataatctctgggagcccattgctgcgtctatgctgcttgac
cctgagctcttgaaggtgattgatgttataggagctcattatcctgggacccatacagta
aaggatgcgaggttgactgagaagaagctttggtcttctgaagatttcagcaccttaaat
aatgatgtgggtgcaggctgctgggctcgagtattgaatcagaattatatcaatggctac
atgacttccacaattgcttggaatttggtggctagttactatgaacagttgccgtatggg
cgatgtggactgatgacagctcaggagccctggagtgggcactatgtagtcgaatctcct
atctggatatcagctcataccactcagtttactcaaccaggttggtattacctgaagaca
gttggccatttagagaaaggaggaagctacgtagctctaactgatggcttaggtaacctc
accatcatcattgaaactatgagccataaacagtctaagtgtatacgaccatttcttcct
tatttcaatgtgtcacgacaatatgctaccttcattcttaagggttcttttagtgaaata
ccagggctacaggtgtggtataccaaactcggaaaaccatctgagaggtttctttttaaa
caactggattctctatggctccccgatggcagtgacagtttcacactggagctgcaagca
gatgagctgttcacgctcaccactctcaccgccggtaccaagggcagctatccagtgcct
ccaagatcccagcccttcccacgcatctataaggatgatttcaatgttgattaccccttt
tttactgaagctccaaattttgctgatcagactggtgtatttgaatactttacaaatatg
gaagaccctggagagcatcgcttcacactacgccaagttctcaatcaacgacccattact
tgggctgctgacgcatacaacacgatcagcgttataggagattacaaatggtccaatgtg
actataaagtgtgatgtttacatagagacccctcagacgggaggtgtgttcattgcagga
agagtaaataaaggtggtatcttgattaggagtgccagaggggttttcttctggattttt
gcaaatggaacctacagagttacaggtgatctagctgggtggatgatatatgctttagga
caagctgacattagagcaaaaaaatggtatacactcactttaactattaagggccatttc
tcctctggcatgttgaatggcaagcctctctggacaaatgtccctgtgaatttcccgaag
aatggctgggctgcgattggaactcacttctttgaatttgcacaatttgacaacttttat
gtggaagccatgggctag

DBGET integrated database retrieval system