KEGG   Equus caballus (horse): 100034130Help
Entry
100034130         CDS       T01058                                 

Gene name
GALC
Definition
galactosylceramidase
Orthology
K01202  
galactosylceramidase [EC:3.2.1.46]
Organism
ecb  Equus caballus (horse)
Pathway
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100034130 (GALC)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100034130 (GALC)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     100034130 (GALC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
24
AA seq 685 aa AA seqDB search
MAESLLQASRQRRAKAMTAAAGSAGRAAVSLLLCALLAPAGAYVLDDSDGLSRELDGIGA
VSGGGATSRLLVNYPEPYRSQILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYA
LDENYFRGYEWWLMKEAKKRNPNITLMGLPWSFPGWLGKGFNWPYVNLQLTAYYVVSWIV
GAKYYHDLDIDYIGIWNERTFDSDYIKVLRRMLNYQGLQQVKIIASDNLWEPIAASMLLD
PELLKVIDVIGAHYPGTHTVKDARLTEKKLWSSEDFSTLNNDVGAGCWARVLNQNYINGY
MTSTIAWNLVASYYEQLPYGRCGLMTAQEPWSGHYVVESPIWISAHTTQFTQPGWYYLKT
VGHLEKGGSYVALTDGLGNLTIIIETMSHKQSKCIRPFLPYFNVSRQYATFILKGSFSEI
PGLQVWYTKLGKPSERFLFKQLDSLWLPDGSDSFTLELQADELFTLTTLTAGTKGSYPVP
PRSQPFPRIYKDDFNVDYPFFTEAPNFADQTGVFEYFTNMEDPGEHRFTLRQVLNQRPIT
WAADAYNTISVIGDYKWSNVTIKCDVYIETPQTGGVFIAGRVNKGGILIRSARGVFFWIF
ANGTYRVTGDLAGWMIYALGQADIRAKKWYTLTLTIKGHFSSGMLNGKPLWTNVPVNFPK
NGWAAIGTHFFEFAQFDNFYVEAMG
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggctgagagcctactccaggcttcccggcaacgccgagcgaaagccatgacggcagcc
gcgggttcggcgggccgcgccgccgtgtccctgctgctgtgtgcgctgttggcgcccgcc
ggcgcgtacgtgctcgacgactccgacgggctgagccgggagttagatggcatcggcgcg
gtcagcggcggcggggcaacttcccggcttctagtaaattacccagagccctatcgttct
caaatattggattatctctttaagccaaacttcggtgcctctttgcatattctaaaagtc
gaaataggtggtgatgggcagacaacagacggcactgagccctcccacatgcactatgca
ctagatgagaattacttccgaggatatgagtggtggttaatgaaggaagctaagaagcgg
aaccctaacattacgctcatggggttgccgtggtccttccctggatggctgggaaaaggt
ttcaactggccctatgtaaatcttcagctgactgcctactatgtcgtgagctggattgtg
ggtgccaagtattatcatgatttggacattgattatattgggatttggaatgagaggaca
tttgatagcgattatatcaaggtgttaagaagaatgctcaactatcaaggtctccagcaa
gtgaaaatcatcgcgagtgataatctctgggagcccattgctgcgtctatgctgcttgac
cctgagctcttgaaggtgattgatgttataggagctcattatcctgggacccatacagta
aaggatgcgaggttgactgagaagaagctttggtcttctgaagatttcagcaccttaaat
aatgatgtgggtgcaggctgctgggctcgagtattgaatcagaattatatcaatggctac
atgacttccacaattgcttggaatttggtggctagttactatgaacagttgccgtatggg
cgatgtggactgatgacagctcaggagccctggagtgggcactatgtagtcgaatctcct
atctggatatcagctcataccactcagtttactcaaccaggttggtattacctgaagaca
gttggccatttagagaaaggaggaagctacgtagctctaactgatggcttaggtaacctc
accatcatcattgaaactatgagccataaacagtctaagtgtatacgaccatttcttcct
tatttcaatgtgtcacgacaatatgctaccttcattcttaagggttcttttagtgaaata
ccagggctacaggtgtggtataccaaactcggaaaaccatctgagaggtttctttttaaa
caactggattctctatggctccccgatggcagtgacagtttcacactggagctgcaagca
gatgagctgttcacgctcaccactctcaccgccggtaccaagggcagctatccagtgcct
ccaagatcccagcccttcccacgcatctataaggatgatttcaatgttgattaccccttt
tttactgaagctccaaattttgctgatcagactggtgtatttgaatactttacaaatatg
gaagaccctggagagcatcgcttcacactacgccaagttctcaatcaacgacccattact
tgggctgctgacgcatacaacacgatcagcgttataggagattacaaatggtccaatgtg
actataaagtgtgatgtttacatagagacccctcagacgggaggtgtgttcattgcagga
agagtaaataaaggtggtatcttgattaggagtgccagaggggttttcttctggattttt
gcaaatggaacctacagagttacaggtgatctagctgggtggatgatatatgctttagga
caagctgacattagagcaaaaaaatggtatacactcactttaactattaagggccatttc
tcctctggcatgttgaatggcaagcctctctggacaaatgtccctgtgaatttcccgaag
aatggctgggctgcgattggaactcacttctttgaatttgcacaatttgacaacttttat
gtggaagccatgggctag

DBGET integrated database retrieval system