KEGG   Equus caballus (horse): 100034152Help
Entry
100034152         CDS       T01058                                 

Gene name
GBE1
Definition
glucan (1,4-alpha-), branching enzyme 1 (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ecb  Equus caballus (horse)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100034152 (GBE1)
Enzymes [BR:ecb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     100034152 (GBE1)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100034152 (GBE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
26
AA seq 699 aa AA seqDB search
MAAPAARADGSDAALAAALADVPDLGRLLEVDPYLKPYAPDFQRRYNRFSQTLDNIGKNE
GGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNDWNPFSYPYKKLDYGKWD
LYIPPKPNKSLLVPHGSKLKVVIRSKSGEILYRISPWAKYVVRESGNVNYDWIHWDPEQP
YKFKHSRPKKPRSLRIYESHVGISSHEGKIASYKHFTCNVLPRIKGLGYNCIQMMAIMEH
AYYASFGYQITSFFAASSRYGTPEELKELVDTAHSMGITVLLDVVHSHASKNSEDGLNMF
DGTDSCYFHSGPRGTHDLWDSRLFIYSSWEVLRFLLSNIRWWLEEYGFDGFRFDGVTSML
YHHHGIGASFSGDYHEYFGLQVDEDALTYLMLANHLVHTLYPDSITIAEDVSGMPALCSP
ISQGGGGFDYRLAMAIPDKWIQLVKEFKDEDWNMGNIVYTLTNRRHLEKCIAYAESHDQA
LVGDKSLAFWLMDAEMYTNMSVLTPFTPVIDRGIQLHKMIRLITHALGGEGYLNFMGNEF
GHPEWLDFPRKGNNESYHYARRQFHLTDDDLLRYKFLNNFDRDMNKLEERCGWLSAPQAF
VSEKHEGNKVIAFERAALLFIFNFHPSKSYTNYRVGTTLPGKFKIVLDSDAAEYGGHQRL
DHNTDFFSEPYEHNERPSSLLVYIPSRVALILQNVDPPN
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgccggcggctcgggccgacggctccgacgcggcgctggcggcggccctggcg
gacgtgcccgacctgggccgccttctggaggtcgacccgtacctgaagccctacgccccg
gacttccagcgcaggtataaccggtttagccagactttggacaacattggaaagaatgaa
ggtggtattgacaagttttccagaggttatgaatcatttggcgtccacagatgtgctgac
gggggcttatactgcaaagagtgggccccgggagcagaaggagtttttcttactggagac
ttcaatgattggaatccattttcgtacccatacaaaaaactggattatggaaaatgggat
ctgtatatcccaccaaagcctaataaatccctcctggtaccgcatggatccaaattaaag
gtagttattaggagtaaaagtggagagatcttgtatcgtatttcaccgtgggcgaagtat
gtggttcgtgaaagtggtaatgtgaattatgattggatacactgggatccagaacagcca
tataaatttaagcattccagaccaaagaagccaagaagtctaagaatttatgaatctcat
gtgggaatttcttcccatgaaggaaaaatagcttcttataaacattttacatgcaacgta
ctaccaagaatcaaaggccttggatacaactgcattcagatgatggcaatcatggagcac
gcttactacgccagttttggttaccagatcacaagcttctttgcagcgtcaagccgttac
ggaacacctgaagagctaaaagaattggttgacaccgctcactcaatgggtattacagtc
ctcttagatgtagtgcacagccatgcctccaaaaattcagaagatggattgaatatgttt
gatgggacagactcctgttattttcattctggacctagagggactcatgatctttgggat
agtcgattgtttatctactccagctgggaagttttaagattccttctgtcaaacataaga
tggtggttggaagaatatggctttgatgggtttcgttttgatggtgttacatccatgctc
tatcatcaccatggaattggtgcaagcttttcaggtgattaccatgaatattttggactc
caagtagatgaagacgccttgacttatctcatgctggccaatcatttggttcacacgttg
tatccggattctatcacaatagctgaggatgtctcaggaatgccggctctgtgttctccg
atttcccagggagggggtggctttgactatagattagccatggcaattccggacaaatgg
atccagctagttaaggagtttaaagatgaagattggaacatgggcaacatagtgtacact
ctcacaaacagacgccaccttgaaaagtgcatcgcttatgcagagagccatgatcaggca
ctcgttggggataagtcactggcattttggttgatggacgccgaaatgtataccaacatg
agtgttctgaccccttttactccagttattgatcgtggaatacagcttcacaaaatgatt
cgactcattactcacgcactcggtggagagggctatctcaatttcatgggtaatgaattt
gggcatccggaatggctagacttcccaagaaaggggaataatgagagctaccattatgcc
agaaggcagtttcatttaactgatgatgaccttcttcgctacaagttcctaaataacttt
gacagggatatgaataaattggaagaaagatgtggttggctttccgctccccaggcattt
gtgagtgaaaagcatgaaggcaataaggtcatcgcttttgagagagcagctcttcttttt
attttcaacttccatccaagcaagagctacaccaattacagagtcggaacgacattgcca
gggaaattcaaaattgtgctagattccgacgcagcggaatatggaggacaccagagattg
gaccacaataccgatttcttttctgagccttatgagcataatgagcgtccctcttcyctt
ttggtgtacattccaagccgagtggccctcattcttcagaacgtggatccgcccaactga

DBGET integrated database retrieval system