KEGG   Equus caballus (horse): 100034175Help
Entry
100034175         CDS       T01058                                 

Definition
(RefSeq) alcohol dehydrogenase S chain
  KO
K13951  alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00010  Glycolysis / Gluconeogenesis
ecb00071  Fatty acid degradation
ecb00350  Tyrosine metabolism
ecb00830  Retinol metabolism
ecb00980  Metabolism of xenobiotics by cytochrome P450
ecb00982  Drug metabolism - cytochrome P450
ecb01100  Metabolic pathways
ecb05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100034175
  Lipid metabolism
   00071 Fatty acid degradation
    100034175
  Amino acid metabolism
   00350 Tyrosine metabolism
    100034175
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100034175
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100034175
   00982 Drug metabolism - cytochrome P450
    100034175
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100034175
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     100034175
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C UDPG_MGDP_dh_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 100034175
NCBI-ProteinID: NP_001075414
UniProt: P00328
Structure
PDB: 

Jmol
Position
3
AA seq 374 aa AA seqDB search
MSTAGKVIKCKAAVLWEQKKPFSIEEVEVAPPKAHEVRIKMVAAGICRSDDHVVSGTLVA
PLPVIAGHEAAGIVESIGEGVTTVRPGDKVIPLFIPQCGKCSVCKHPEGNLCLKNLSMPR
GTMQDGTSRFTCRGKPIHHFLGTSTFSQYTVVDEISVAKIDAASPLEKVCLVGCGFSTGY
GSAVKVAKVTQGSTCAVFGLGGVGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATEC
VNPQDYKKPIQEVLTEMSNGGVDFSFEVIGRLDTMVAALSCCQEAYGVSVIVGVPPDSQN
LSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLITHVLPFEKINEGFD
LLRSGKSIRTILTF
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagcaggaaaagtaataaaatgcaaagcagctgtgctgtgggagcaaaagaaa
ccattttccatagaggaggtggaggtcgcacccccgaaggcccatgaagtccgtataaag
atggtggccgcaggaatctgtcgctcagatgaccacgtggttagtggaacccttgtcgca
cctcttcctgtgatcgcaggccatgaggcagctggcattgtggagagcatcggagaaggc
gtcactacagtaagaccaggtgataaagtcatcccactctttattccccagtgtggaaaa
tgcagtgtttgtaaacaccctgaaggcaacctctgcttgaaaaatctgagcatgcctcgg
ggaaccatgcaggatggtaccagcaggttcacctgcagagggaagcccatccaccacttc
cttggcaccagcaccttctcccagtacaccgtggtggacgagatctcagtggccaagatc
gatgcggcctcaccgctggagaaagtctgtctcgttggctgtggattttctactggttat
gggtctgcagtcaaggttgccaaggtcacccagggctccacctgtgccgtgtttggcctt
ggaggagtgggcctgtctgttatcatgggctgtaaagcagccggagcggccaggatcatt
ggggtggacatcaacaaagacaagtttgcaaaggccaaagaagtgggtgccactgagtgt
gtcaaccctcaggactacaagaaacccatccaggaggtgctgacagaaatgagcaatgga
ggcgtggatttttcatttgaagtcattggtcggcttgacaccatggtggctgccttgtca
tgctgtcaagaagcatatggtgtgagcgtcatcgtaggagtacctcctgattcccaaaat
ctctctatgaatcccatgttgctactgagtggacgtacctggaaaggagctatttttggt
ggttttaagagtaaagattctgtccccaaacttgtggccgattttatggctaaaaagttt
gcactggatcctttaatcacccatgttttaccttttgaaaaaataaatgaaggatttgac
ctgcttcgctctggaaagagtatccgtaccatcctgacgttttga

DBGET integrated database retrieval system