KEGG   Equus caballus (horse): 100034187Help
Entry
100034187         CDS       T01058                                 

Gene name
IL10, IL-10
Definition
interleukin 10
Orthology
K05443  
interleukin 10
Organism
ecb  Equus caballus (horse)
Pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Jak-STAT signaling pathway
T cell receptor signaling pathway
Intestinal immune network for IgA production
Pertussis
Leishmaniasis
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Malaria
Toxoplasmosis
Amoebiasis
Staphylococcus aureus infection
Tuberculosis
Epstein-Barr virus infection
Asthma
Autoimmune thyroid disease
Inflammatory bowel disease (IBD)
Systemic lupus erythematosus
Allograft rejection
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:ecb04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:ecb04068]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:ecb04060]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:ecb04660]
Organismal Systems; Immune system; Intestinal immune network for IgA production [PATH:ecb04672]
Human Diseases; Immune diseases; Asthma [PATH:ecb05310]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:ecb05322]
Human Diseases; Immune diseases; Autoimmune thyroid disease [PATH:ecb05320]
Human Diseases; Immune diseases; Inflammatiory bowel disease (IBD) [PATH:ecb05321]
Human Diseases; Immune diseases; Allograft rejection [PATH:ecb05330]
Human Diseases; Infectious diseases; Pertussis [PATH:ecb05133]
Human Diseases; Infectious diseases; Staphylococcus aureus infection [PATH:ecb05150]
Human Diseases; Infectious diseases; Tuberculosis [PATH:ecb05152]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:ecb05169]
Human Diseases; Infectious diseases; Amoebiasis [PATH:ecb05146]
Human Diseases; Infectious diseases; Malaria [PATH:ecb05144]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:ecb05145]
Human Diseases; Infectious diseases; Leishmaniasis [PATH:ecb05140]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:ecb05142]
Human Diseases; Infectious diseases; African trypanosomiasis [PATH:ecb05143]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 178 aa AA seqDB search
MHSSALLCYLVFLAGVGASRDRGTQSENSCTHFPTSLPHMLHELRAAFSRVKTFFQMKDQ
LDNMLLNGSLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHGPDIKEHVNSLGEKLKTLR
VRLRRCHRFLPCENKSKAVEQVKSAFSKLQEKGVYKAMSEFDIFINYIEAYMTTKMKN
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgcacagctcagcactgctatgttacctggtcttcctggccggggtgggagccagccga
gaccggggcacccagtctgagaacagctgcacccacttcccaaccagcctgccccacatg
ctccatgagctccgagccgccttcagcagggtgaagactttctttcaaatgaaggaccag
ctggacaacatgttgttgaacgggtccctgctggaggactttaagggttacctgggttgc
caagccttgtcggagatgatccagttttacctggaggaggtgatgccccaggctgagaac
cacggcccagacatcaaggagcacgtgaactccctgggggaaaagctgaagaccctccga
gtgaggctgcggcgctgtcatcgatttctgccctgtgaaaataagagcaaggcagtggag
caggtgaagagtgccttcagtaagctccaagagaaaggtgtctacaaagccatgagtgag
tttgacatcttcatcaactacatagaagcctatatgacaacgaagatgaaaaactga

DBGET integrated database retrieval system