KEGG   Equus caballus (horse): 100034187Help
Entry
100034187         CDS       T01058                                 

Gene name
IL10, IL-10
Definition
interleukin 10
Orthology
K05443  
interleukin 10
Organism
ecb  Equus caballus (horse)
Pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Jak-STAT signaling pathway
T cell receptor signaling pathway
Intestinal immune network for IgA production
Pertussis
Leishmaniasis
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Malaria
Toxoplasmosis
Amoebiasis
Staphylococcus aureus infection
Tuberculosis
Epstein-Barr virus infection
Asthma
Autoimmune thyroid disease
Inflammatory bowel disease (IBD)
Systemic lupus erythematosus
Allograft rejection
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    100034187 (IL10)
   04068 FoxO signaling pathway
    100034187 (IL10)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100034187 (IL10)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    100034187 (IL10)
   04672 Intestinal immune network for IgA production
    100034187 (IL10)
 Human Diseases
  Immune diseases
   05310 Asthma
    100034187 (IL10)
   05322 Systemic lupus erythematosus
    100034187 (IL10)
   05320 Autoimmune thyroid disease
    100034187 (IL10)
   05321 Inflammatiory bowel disease (IBD)
    100034187 (IL10)
   05330 Allograft rejection
    100034187 (IL10)
  Infectious diseases
   05133 Pertussis
    100034187 (IL10)
   05150 Staphylococcus aureus infection
    100034187 (IL10)
   05152 Tuberculosis
    100034187 (IL10)
   05169 Epstein-Barr virus infection
    100034187 (IL10)
   05146 Amoebiasis
    100034187 (IL10)
   05144 Malaria
    100034187 (IL10)
   05145 Toxoplasmosis
    100034187 (IL10)
   05140 Leishmaniasis
    100034187 (IL10)
   05142 Chagas disease (American trypanosomiasis)
    100034187 (IL10)
   05143 African trypanosomiasis
    100034187 (IL10)
Heparan sulfate/heparin binding proteins [BR:ecb00536]
 Cytokines (General comment) Chemotaxis, singal transduction, inflammation
  100034187 (IL10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 178 aa AA seqDB search
MHSSALLCYLVFLAGVGASRDRGTQSENSCTHFPTSLPHMLHELRAAFSRVKTFFQMKDQ
LDNMLLNGSLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHGPDIKEHVNSLGEKLKTLR
VRLRRCHRFLPCENKSKAVEQVKSAFSKLQEKGVYKAMSEFDIFINYIEAYMTTKMKN
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgcacagctcagcactgctatgttacctggtcttcctggccggggtgggagccagccga
gaccggggcacccagtctgagaacagctgcacccacttcccaaccagcctgccccacatg
ctccatgagctccgagccgccttcagcagggtgaagactttctttcaaatgaaggaccag
ctggacaacatgttgttgaacgggtccctgctggaggactttaagggttacctgggttgc
caagccttgtcggagatgatccagttttacctggaggaggtgatgccccaggctgagaac
cacggcccagacatcaaggagcacgtgaactccctgggggaaaagctgaagaccctccga
gtgaggctgcggcgctgtcatcgatttctgccctgtgaaaataagagcaaggcagtggag
caggtgaagagtgccttcagtaagctccaagagaaaggtgtctacaaagccatgagtgag
tttgacatcttcatcaactacatagaagcctatatgacaacgaagatgaaaaactga

DBGET integrated database retrieval system