KEGG   Equus caballus (horse): 100034187Help
Entry
100034187         CDS       T01058                                 

Gene name
IL10
Definition
(RefSeq) interleukin-10 precursor
  KO
K05443  interleukin 10
Organism
ecb  Equus caballus (horse)
Pathway
ecb04060  Cytokine-cytokine receptor interaction
ecb04068  FoxO signaling pathway
ecb04625  C-type lectin receptor signaling pathway
ecb04630  Jak-STAT signaling pathway
ecb04660  T cell receptor signaling pathway
ecb04672  Intestinal immune network for IgA production
ecb05133  Pertussis
ecb05140  Leishmaniasis
ecb05142  Chagas disease (American trypanosomiasis)
ecb05143  African trypanosomiasis
ecb05144  Malaria
ecb05145  Toxoplasmosis
ecb05146  Amoebiasis
ecb05150  Staphylococcus aureus infection
ecb05152  Tuberculosis
ecb05169  Epstein-Barr virus infection
ecb05310  Asthma
ecb05320  Autoimmune thyroid disease
ecb05321  Inflammatory bowel disease (IBD)
ecb05322  Systemic lupus erythematosus
ecb05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    100034187 (IL10)
   04068 FoxO signaling pathway
    100034187 (IL10)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100034187 (IL10)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    100034187 (IL10)
   04660 T cell receptor signaling pathway
    100034187 (IL10)
   04672 Intestinal immune network for IgA production
    100034187 (IL10)
 Human Diseases
  Immune diseases
   05310 Asthma
    100034187 (IL10)
   05322 Systemic lupus erythematosus
    100034187 (IL10)
   05320 Autoimmune thyroid disease
    100034187 (IL10)
   05321 Inflammatiory bowel disease (IBD)
    100034187 (IL10)
   05330 Allograft rejection
    100034187 (IL10)
  Infectious diseases
   05133 Pertussis
    100034187 (IL10)
   05150 Staphylococcus aureus infection
    100034187 (IL10)
   05152 Tuberculosis
    100034187 (IL10)
   05169 Epstein-Barr virus infection
    100034187 (IL10)
   05146 Amoebiasis
    100034187 (IL10)
   05144 Malaria
    100034187 (IL10)
   05145 Toxoplasmosis
    100034187 (IL10)
   05140 Leishmaniasis
    100034187 (IL10)
   05142 Chagas disease (American trypanosomiasis)
    100034187 (IL10)
   05143 African trypanosomiasis
    100034187 (IL10)
Cytokines and growth factors [BR:ecb04052]
 Cytokines
  Interleukins
   100034187 (IL10)
Glycosaminoglycan binding proteins [BR:ecb00536]
 Heparan sulfate/Haparin
  Cytokines (General comment) Chemotaxis, singal transduction, inflammation
   100034187 (IL10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL10 IL22 CLZ Helicase_IV_N
Motif
Other DBs
NCBI-GeneID: 100034187
NCBI-ProteinID: NP_001075959
Ensembl: ENSECAG00000009179
UniProt: Q28374 B1AB84
Position
5
AA seq 178 aa AA seqDB search
MHSSALLCYLVFLAGVGASRDRGTQSENSCTHFPTSLPHMLHELRAAFSRVKTFFQMKDQ
LDNMLLNGSLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHGPDIKEHVNSLGEKLKTLR
VRLRRCHRFLPCENKSKAVEQVKSAFSKLQEKGVYKAMSEFDIFINYIEAYMTTKMKN
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgcacagctcagcactgctatgttacctggtcttcctggccggggtgggagccagccga
gaccggggcacccagtctgagaacagctgcacccacttcccaaccagcctgccccacatg
ctccatgagctccgagccgccttcagcagggtgaagactttctttcaaatgaaggaccag
ctggacaacatgttgttgaacgggtccctgctggaggactttaagggttacctgggttgc
caagccttgtcggagatgatccagttttacctggaggaggtgatgccccaggctgagaac
cacggcccagacatcaaggagcacgtgaactccctgggggaaaagctgaagaccctccga
gtgaggctgcggcgctgtcatcgatttctgccctgtgaaaataagagcaaggcagtggag
caggtgaagagtgccttcagtaagctccaagagaaaggtgtctacaaagccatgagtgag
tttgacatcttcatcaactacatagaagcctatatgacaacgaagatgaaaaactga

DBGET integrated database retrieval system