KEGG   Equus caballus (horse): 100034242Help
Entry
100034242         CDS       T01058                                 

Definition
alcohol dehydrogenase-E-isoenzyme (EC:1.1.1.1)
Orthology
K13951  
alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
ecb  Equus caballus (horse)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100034242
  Lipid metabolism
   00071 Fatty acid degradation
    100034242
  Amino acid metabolism
   00350 Tyrosine metabolism
    100034242
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100034242
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100034242
   00982 Drug metabolism - cytochrome P450
    100034242
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100034242
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     100034242
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
3
AA seq 375 aa AA seqDB search
MSTAGKVIKCKAAVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVT
PLPVIAGHEAAGIVESIGEGVTTVRPGDKVIPLFTPQCGKCRVCKHPEGNFCLKNDLSMP
RGTMQDGTSRFTCRGKPIHHFLGTSTFSQYTVVDEISVAKIDAASPLEKVCLIGCGFSTG
YGSAVKVAKVTQGSTCAVFGLGGVGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATE
CVNPQDYKKPIQEVLTEMSNGGVDFSFEVIGRLDTMVTALSCCQEAYGVSVIVGVPPDSQ
NLSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLITHVLPFEKINEGF
DLLRSGESIRTILTF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagcaggaaaagtaataaaatgcaaagcggctgtgctgtgggaggaaaagaaa
ccattttccatcgaggaggtggaggttgcacccccgaaggcccatgaagtccgtataaag
atggtggccacaggaatttgtcgctcagatgaccacgtggttagtggaacccttgtcaca
cctcttcctgtgatcgcaggccatgaggcagcgggcattgtggagagcattggagaaggc
gtcactacagtaagaccaggtgataaagtcatcccactctttactccccagtgtggaaaa
tgcagggtttgtaagcaccctgaaggcaacttctgcttgaaaaatgatctgagcatgcct
cggggaaccatgcaggatggtaccagcaggttcacctgcagagggaagcccatccaccac
ttccttggcaccagcaccttctcccagtacaccgtggtggacgagatctcagtggccaag
atcgatgcggcctcaccgctggagaaagtctgtctcattggctgtggattttctactggt
tatgggtctgcagtcaaggttgccaaggtcacccagggctccacctgtgccgtgtttggc
cttggaggagtgggcctgtctgttatcatgggctgtaaagcagccggagcggccaggatc
attggggtggacatcaacaaagacaagtttgcaaaggccaaagaagtgggtgccactgag
tgtgtcaaccctcaggactacaagaaacccatccaggaggtgctgacagaaatgagcaat
ggaggtgtggatttttcctttgaagtcattggtcggctcgacactatggtgactgccttg
tcatgctgtcaagaagcatatggtgtgagcgtcattgtgggagtacctcctgattcccaa
aatctctctatgaatcctatgttgctactgagtggacgtacctggaaaggagctattttt
ggcggttttaagagtaaagattctgtccccaaacttgtggccgattttatggctaaaaag
tttgcactggatcctttaatcacccatgttttaccttttgaaaaaataaatgaaggattt
gacctgcttcgctctggagagagtatccgtaccatcctgacgttttga

DBGET integrated database retrieval system